
Write the model and serial
numbers here:
Model # _________________
Serial # _________________
You can find them on a label
behind the door or drawer.
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
OWNER’S MANUAL
RANGES
Electric Front Control
49-2000866 Rev. 0 11-20 GEA
30" Front Control Range
PS960
GE is a trademark of the General Electric Company. Manufactured under trademark license.
SAFETY INFORMATION .......... 3
USING THE RANGE
Surface Units ........................... 7
Cookware for Radiant Glass Cooktop. . . . . .10
Oven Controls ..........................11
Cooking Options. . . . . . . . . . . . . . . . . . . . . . . .12
Settings ...............................12
Sabbath Mode ..........................14
Oven Racks ............................15
Aluminum Foil and Oven Liners ...........15
Oven Cookware ........................15
Cooking Modes .........................15
Probe .................................17
Oven Cooking Guide ....................18
Air Fry Cooking Guide ...................19
CARE AND CLEANING
Cleaning the Range – Exterior ...........20
Cleaning the Range – Interior ............21
Cleaning the Glass Cooktop .............22
Probe ................................ 23
Oven Light ............................24
Oven Door ............................ 25
TROUBLESHOOTING TIPS .......26
LIMITED WARRANTY ............30
ACCESSORIES .....................31
CONSUMER SUPPORT ........... 32

2 49-2000866 Rev. 0
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.

49-2000866 Rev. 0 3
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
ANTI-TIP DEVICE
To reduce the risk of tipping the range,
the range must be secured by a properly
installed anti-tip bracket. See installation
instructions shipped with the bracket for
complete details before attempting to install.
For Free-Standing and Slide-In Ranges
To check if the bracket is installed and
engaged properly, look underneath the
range to see that the rear leveling leg is
engaged in the bracket. On some models, the storage drawer or kick panel
can be removed for easy inspection. If visual inspection is not possible,
slide the range forward, confirm the anti-tip bracket is securely attached to
the floor or wall, and slide the range back so the rear leveling leg is under
the anti-tip bracket.
If the range is pulled from the wall for any reason, always repeat this
procedure to verify the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured
to the anti-tip device properly.
WARNING
Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
•
Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING
Anti-Tip
Bracket
Leveling Leg
Free-Standing and Slide-In Ranges
WARNING
GENERAL SAFETY INSTRUCTIONS
■ Usethisapplianceonlyforitsintendedpurposeas
described in this Owner’s Manual.
■ Haveyourrangeinstalledandproperlygroundedby
a qualified installer in accordance with the provided
installation instructions.
■ Anyadjustmentandserviceshouldbeperformed
only by a qualified installer or service technician.
Do not attempt to repair or replace any part of your
range unless it is specifically recommended in this
manual.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Donotleavechildrenalone—childrenshouldnot
be left alone or unattended in an area where an
appliance is in use. They should never be allowed
to climb, sit or stand on any part of the appliance.
■
CAUTION
Do not store items of interest to
children above a range or on the backguard of a
range—childrenclimbingontherangetoreach
items could be seriously injured.
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam. Do not let pot holders touch hot surface
units or heating elements. Do not use a towel or
other bulky cloth in place of pot holders.
■ Neveruseyourapplianceforwarmingorheating
the room.
■ Besureallpackingmaterialsareremovedfromthe
range before operating to prevent ignition of these
materials.
■ Donotuseanytypeoffoilorlinertocoverthe
oven bottom or anywhere in the oven, except as
described in this manual. Oven liners can trap heat
or melt, resulting in damage to the product and risk
of shock, smoke or fire.
■ Ifaheatingelement,eitheronasurfaceunitorin
the oven, develops a glowing spot or shows other
signs of damage, do not use that area of the range.
A glowing spot indicates the surface unit may fail
and present a potential burn, fire, or shock hazard.
Turn the heating element off immediately and have
it replaced by a qualified service technician.

4 49-2000866 Rev. 0
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING
KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
WARNING
IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickup
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
tray.Useamulti-purposedrychemicalorfoam-type
fire extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheovenduringself-clean,turn
the oven off and wait for the fire to go out. Do not
force the door open. Introduction of fresh air at self-
clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
WARNING
COOKTOP SAFETY INSTRUCTIONS
■ Never leave the surface units unattended. Boilovers
cause smoking and greasy spillovers that may
ignite.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets.Useadeepfatthermometerwhenever
possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,useaminimum
amount of oil when shallow pan-frying and avoid
cooking frozen foods with excessive amounts of ice.
■ Useproperpansize—selectcookwarehaving
flat bottoms large enough to cover the surface
heating element. The use of undersized cookware
will expose a portion of the surface unit to direct
contact and may result in ignition of clothing. Proper
relationship of cookware to surface unit will also
improve efficiency.
WARNING
GENERAL SAFETY INSTRUCTIONS (Cont.)
■ Donottouchthesurfaceunits,theheatingelements
or the interior surface of the oven. These surfaces
may be hot enough to burn even though they are
dark in color. During and after use, do not touch,
or let clothing or other flammable materials contact
the surface units, areas nearby the surface units or
any interior area of the oven; allow sufficient time
for cooling first. Other surfaces of the appliance
may become hot enough to cause burns. Potentially
hot surfaces include the cooktop, areas facing the
cooktop, oven vent opening, surfaces near the
opening and crevices around the oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.
■ Avoidscratchingorimpactingglassdoors,cook
tops or control panels. Doing so may lead to glass
breakage. Do not cook on a product with broken
glass. Shock, fire or cuts may occur. Contact a
qualified technician immediately.
■ Cookfoodthoroughlytohelpprotectagainst
foodborne illness. Minimum safe food temperature
recommendations can be found at IsItDoneYet.gov
and fsis.usda.gov.Useafoodthermometertotake
food temperatures and check several locations.
■
Do not allow anyone to climb, stand, or hang on the
oven door, drawer, or cooktop. They could damage
the range or tip it over, causing severe injury or death.

49-2000866 Rev. 0 5
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING
COOKTOP SAFETY INSTRUCTIONS
■ Whenusingglass/ceramiccookware,makesureit
is suitable for cooktop service; others may break
because of sudden change in temperature.
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby surface units.
■ Whenpreparingflamingfoodsunderahood,turn
the fan on.
■ Ifpowerislosttoanelectriccooktopwhilea
surface unit is ON, the surface unit will turn back on
as soon as power is restored.
■ Intheeventofpowerloss,failuretoturnallsurface
unit knobs to the OFF position may result in ignition
of items on or near the cooktop, leading to serious
injury or death.
■ Donotcookonabrokencooktop.Ifglasscooktop
should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
■ Avoidscratchingtheglasscooktop.Thecooktop
can be scratched with items such as knives, sharp
instruments, rings or other jewelry, and rivets on
clothing.
■ Donotplaceorstoreitemsthatcanmeltorcatch
fire on the glass cooktop, even when it is not being
used. If the cooktop is inadvertently turned on, they
may ignite. Heat from the cooktop or oven vent after
it is turned off may cause them to ignite also.
■ Useceramiccooktopcleanerandnon-scratch
cleaning pad to clean the cooktop. Wait until the
cooktop cools and the indicator light goes out
before cleaning. A wet sponge or cloth on a hot
surface can cause steam burns. Some cleaners can
produce noxious fumes if applied to a hot surface.
NOTE: Sugar spills are an exception. They should
be scraped off while still hot using an oven mitt
and a scraper. See the Cleaning the glass cooktop
section for detailed instructions.
WARNING
OVEN SAFETY INSTRUCTIONS
■ Keeptheovenventunobstructed.
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burnstohands,faceand/oreyes.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
■ Donotleaveitemsonthecooktopneartheoven
vent. Items may overheat resulting in a risk of fire or
burns.
■ Donotleaveitemssuchaspaper,cookingutensils
or food in the oven when not in use. Items stored in
an oven can ignite.
WARNING
RADIANT COOKTOP SAFETY INSTRUCTIONS
Usecarewhentouchingthecooktop.Theglasssurfaceofthecooktopwillretainheatafterthecontrolshave
been turned off. Clean cooktop With Caution – If a wet sponge or cloth is used to wipe spills on a hot cooking
area, be careful to avoid steam burn. Some cleaners can produce noxious fumes if applied to a hot surface.

6 49-2000866 Rev. 0
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time.w
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
Remote Enable Equipment
This device complies with part 15 of the FCC Rules.
Operation is subject to the following two conditions: (1)
This device may not cause harmful interference, and
(2) this device must accept any interference received,
including interference that may cause undesired operation.
The wireless communication equipment installed on this
range has been tested and found to comply with the
limits for a Class B digital device, pursuant to part 15 of
the FCC Rules. These limits are designed to:
(a) provide reasonable protection against harmful
interference in a residential installation. This equipment
generates, uses, and can radiate radio frequency energy
and, if not installed and used in accordance with the
instructions, may cause harmful interference to radio
communications. However, there is no guarantee that
interference will not occur in a particular installation. If
this equipment does cause harmful interference to radio
or television reception, which can be determined by
turning the equipment off and on, the user is encouraged
to try to correct the interference by one or more of the
following measures:
■Reorientorrelocatethereceivingantenna.
■Increasetheseparationbetweentheequipmentand
receiver.
■Connecttheequipmentintoanoutletonacircuit
different from that to which the receiver is connected.
■Consultthedealeroranexperiencedradio/TV
technician for help.
(b) accept any interference received, including interference
that may cause undesired operation of the device.
Note that any changes or modifications to the wireless
communication device installed on this oven that are not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.
WARNING
SELF-CLEANING OVEN SAFETY INSTRUCTIONS
The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven.
Follow these instructions for safe operation.
■ Donottouchovensurfacesduringself-clean
operation.Keepchildrenawayfromtheovenduring
self-cleaning. Failure to follow these instructions
may cause burns.
■ Beforeoperatingtheself-cleancycle,removepans,
shiny metal oven racks and other utensils from the
oven. Only gray porcelain-coated oven racks may
be left in the oven. Do not use self-clean to clean
other parts, such as drip pans or bowls.
■ Beforeoperatingtheself-cleancycle,wipegrease
and food soils from the oven. Excessive amount
of grease may ignite leading to smoke damage to
your home.
■ Iftheself-cleaningmodemalfunctions,turnthe
oven off and disconnect the power supply. Have it
serviced by a qualified technician.
■ Donotcleanthedoorgasket.Thedoorgasketis
essential for a good seal. Care should be taken not
to rub, damage or move the gasket.
■ Donotuseaprotectivecoatingtolinetheovenand
do not use commercial oven cleaner unless certified
for use in a self-cleaning oven.

49-2000866 Rev. 0 7
Surface Units
Operating the Cooktop Elements
WARNING
FIRE HAZARD: Never leave the
range unattended with the cooktop on medium or
high settings. Keep flammable items away from the
cooktop. Turn off all controls when done cooking.
Failure to follow these instructions can result in fire,
serious injury or death.
Before using the cooktop for the first time, clean it with
ceramic cooktop cleaner. This helps protect the top and
makes cleanup easier.
Turn element(s) On: Touch and hold On/Off pad about
half a second. A chime can be heard with each touch to
any pad.
Power level can be selected in any of the following ways:
1. Swipe the gray arc (on the graphics) to the desired
power level. There is no sensor on the LEDs, or;
2. Touch Anywhere along the gray arc, or;
3. Touch + or - pads to adjust power level, or;
4. Shortcut to Hi: Immediately after turning unit on, touch
the + pad, or;
5. Shortcut to Low: Immediately after turning unit on,
touch the - pad.
NOTE: When changing from a high heat setting to a
lower heat setting, the surface unit may stop glowing.
This is normal. The unit is still on and hot.
NOTE: This cooktop has a rapid heat-up feature. If the
cooktop is cool when turned on, it will glow red for a short
period of time until the desired power setting is reached.
Multi-Ring Burner (Can be Dual or Triple)
To Turn On/Off
1. Touch the On/Off pad for the right front surface unit.
2. Usethearcor+ or – pad to choose the desired
power setting.
3. Touch the Burner Size pad as needed to select the
desired burner size.
The light next to the Burner Size pad indicates which
size the surface unit is on. To turn the surface unit off,
touch the On/Off pad.
Gray Arc
Swipe Area
LED
Lights
Gray Arc
Swipe Area
OR
USING THE RANGE: SurfaceUnits

8 49-2000866 Rev. 0
Surface Units (Cont.)
Using the Warming Zone
WARNING
FOOD POISON HAZARD: Bacteria may grow in food at
temperatures below 140°F.
■ Always start with hot food. Do not use warm setting to
heat cold food.
■ Do not use warm setting for more than 2 hours.
The WARMING ZONE, located in the back center of
the glass surface, will keep hot, cooked food at serving
temperature. Always start with hot food. Do not use to
heat cold food. Placing uncooked or cold food on the
WARMING ZONE could result in foodborne illness.
To use the WARMING ZONE:
Press the WARMING ZONE pad and select the desired
level (1, 2 or 3) using the number pads.
To turn off the WARMING ZONE:
Press the WARMING ZONE pad.
NOTE: Cancel/OffwillNOTturnoffthewarmingzone.
For best results, all foods on the WARMING ZONE
should be covered with a lid or aluminum foil. When
warming pastries or breads, the cover should be vented
to allow moisture to escape.
The initial temperature, type and amount of food, type of
pan, and the time held will affect the quality of the food.
Always use pot holders or oven mitts when removing
food from the WARMING ZONE, since cookware and
plates will be hot.
NOTE: The surface warmer will not glow red.
How To Synchronize Left Elements
To Turn On
Hold the Sync Burners pad for about half a second to
connect the two elements. Operate either element as
described in Operating the Cooktop Elements to adjust
power level.
To Turn Off
1. Touch the On/Off pad on either element to turn off
the Sync Burners.
or
2. Touch the Sync Burners to turn both elements off.
USING THE RANGE:SurfaceUnits

49-2000866 Rev. 0 9
USING THE RANGE: SurfaceUnits
Home Canning Tips
Be sure the canner is centered over the surface unit.
Make sure the canner is flat on the bottom.
To prevent burns from steam or heat, use caution when
canning.
Userecipesandproceduresfromreputablesources.
These are available from manufacturers such as Ball
®
andKerr
®
and the Department of Agriculture Extension
Service.
Flat-bottomedcannersarerecommended.Useofwater
bath canners with rippled bottoms may extend the time
required to bring the water to a boil.
Temperature Limiter on Radiant Glass Cooktops
Every radiant surface unit has a temperature limiter.
The temperature limiter protects the glass cooktop from
getting too hot.
The temperature limiter may cycle the surface units off
for a time if:
■ thepanboilsdry.
■ thepanbottomisnotflat.
■ thepanisoff-center.
■ thereisnopanontheunit.
Radiant Glass Cooktop
The radiant cooktop features heating units beneath a
smooth glass surface.
NOTE: A slight odor is normal when a new cooktop is
used for the first time. It is caused by the heating of new
parts and insulating materials and will disappear in a
short time.
NOTE: On models with light-colored glass cooktops, it is
normal for the cooking zones to change color when hot
or cooling down. This is temporary and will disappear as
the glass cools to room temperature.
The surface unit will cycle on and off to maintain your
selected control setting.
It is safe to place hot cookware on the glass surface
even when the cooktop is cool.
Even after the surface units are turned off, the glass
cooktop retains enough heat to continue cooking. To
avoid overcooking, remove pans from the surface units
when the food is cooked. Avoid placing anything on the
surface unit until it has cooled completely.
■ Waterstains(mineraldeposits)areremovableusing
the cleaning cream or full-strength white vinegar.
■ Useofwindowcleanermayleaveaniridescentfilmon
the cooktop. The cleaning cream will remove this film.
■ Don’tstoreheavyitemsabovethecooktop.Ifthey
drop onto the cooktop, they can cause damage.
■ Donotusethesurfaceasacuttingboard.
Surface Units (Cont.)
Never cook directly on the glass. Always
use cookware.
Always place the pan in the center of the
surface unit you are cooking on.
Do not slide cookware across the cooktop because
itcanscratchtheglass—theglassisscratch-
resistant, not scratch proof.

10 49-2000866 Rev. 0
Cookware for Radiant Glass Cooktop
The following information will help you choose cookware which will give good performance on glass cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the ceramic cooktop.
Recommended
Stainless Steel
Aluminum:
heavy weight recommended
Good conductivity. Aluminum residues
sometimes appear as scratches on the
cooktop but can be removed if cleaned
immediately. Because of its low melting
point, thin weight aluminum should not
be used.
Copper Bottom:
Copper may leave residues which can
appear as scratches. The residues can
be removed, as long as the cooktop
is cleaned immediately. However, do
not let these pots boil dry. Overheated
metal can bond to glass cooktops. An
overheated copper bottom pot will leave
a residue that will permanently stain the
cooktop if not removed immediately.
Enamel (painted) on Cast Iron:
recommended if bottom of pan is coated
Avoid/Not Recommended
Enamel (painted) on Steel:
Heating empty pans can cause
permanent damage to cooktop glass.
The enamel can melt and bond to the
ceramic cooktop.
Glass-ceramic:
Poor performance. Will scratch the
surface.
Stoneware:
Poor performance. May scratch the
surface.
Cast Iron:
notrecommended—unlessdesigned
specifically for glass cooktops
Poor conductivity and slow to absorb
heat. Will scratch the cooktop surface.
Check pans for flat bottoms by
using a straight edge.
Pans with rounded, curved,
ridged or warped bottoms are
not recommended.
For Best Results
■ Placeonlydrypansonthesurfaceelements.Donot
place lids on the surface elements, particularly wet lids.
Wet pans and lids may stick to the surface when cool.
■ Donotusewoksthathavesupportrings.Thistypeof
wok will not heat on glass surface elements.
■ Werecommendthatyouuseonlyaflat-bottomed
wok. They are available at your local retail store. The
bottom of the wok should have the same diameter as
the surface element to ensure proper contact.
■ Somespecialcookingproceduresrequirespecific
cookware such as pressure cookers or deep-fat
fryers. All cookware must have flat bottoms and be
the correct size.
Do not place wet pans on the glass cooktop.
Do not use woks with support rings on the glass cooktop.
Useflat-bottomedwoksontheglasscooktop.
USING THE RANGE: Cookware for Radiant Glass Cooktop

49-2000866 Rev. 0 11
USING THE RANGE: Oven Controls
1. Upper Oven and Lower Oven:
Designates which oven the controls will operate.
Select an oven before following the steps for
starting a cooking or cleaning mode.
2. Convection Cooking Modes: Convection
cooking modes use increased air circulation to
improve performance. See the Cooking Modes
section for more information.
Convection Bake is enabled on your oven.
Use WiFi connect to enable the Convect Roast
feature.
3. Traditional Cooking Modes: Your oven
has the following traditional cooking modes: Bake,
Broil, and Warm. See the Cooking Modes section
for more information.
4. Clean: Your oven has two cleaning modes: Self
Clean and Steam Clean. See the Cleaning the
Oven section for important information about using
these modes.
5. Start/Enter: Must be pressed to start any
cooking, cleaning, or timed function. Also used to
start the Warming Zone on the cooktop.
6. Cancel/Off: Cancels ALL oven operations
except the clock and timer. Does NOT cancel the
Warming Zone on the cooktop.
7. Timer: Works as a countdown timer. Press the
Timer pad and number pads to program the time in
hours and minutes. Press the Start pad. The timer
countdown is complete. To turn the timer off press
the Timer pad.
8. Air Fry: The Air Fry mode is designed to produce
foods with a crispier exterior than traditional oven
cooking. See the Oven Cooking Modes section for
more information.
Use WiFi connect to enable the Air Fry feature.
9. Oven Light: Turns the oven light on or off.
10. Lock Controls: Locks out the control so that
pressing the pads does not activate the controls.
Press and hold the 0 pad, for three seconds to lock
or unlock the control. Cancel/Off is always active,
even when the control is locked. NOTE: Locking
Controls will cancel any function that is currently
running.
11. Cooking Options and Settings: The
Options and Settings pads open up more detailed
menus in the display that allow access to additional
functions and cooking modes. For each you select
the function in the display using the associated
number pad. You can exit at any time by pressing
the Options or Settings pad again. See the
Settings, Options, and Cooking Modes Sections for
more details.
Oven Controls
59
10
8
6
11
3
11
7
1
1
24

12 49-2000866 Rev. 0
* Compatible Apple or Android devices and home WiFi network required.
Cooking Options
The options pad opens up a menu of more cooking modes when the oven is off. It opens a menu with additional
features if a cooking mode is already in process. You can exit the menu at any time by pressing the Options pad
again.
You must first select an oven and a mode (bake, convection bake, convection roast) and then select Options
to get to the following functions.
Cook Time
Counts down cooking time and turns off the oven when
the cooking time is complete. Select a desired cooking
mode.Usethenumberpadstoprogramabaking
temperature. Press the Cooking Options pad and
select Cook Time.Usethenumberpadtoprogram
cook time in hours and minutes. Then press Start/Enter.
This can only be used with Bake, Convection Bake, and
Convection Roast.
Delay Time
Delayswhentheovenwillturnon.Usethistoseta
time when you want the oven to start. Press the desired
cookingmodepad.Usethenumberpadtoprograma
baking temperature. Press the Cooking Options pad
and select Delay Time.Usethenumberpadstoprogram
the time of day for the oven to turn on, and then press
Start/Enter. Delay Time is not available with all modes.
NOTE: When using the Delay Time feature, foods that
spoil easily – such as milk, eggs, fish, stuffing, poultry,
and port – should not be allowed to sit for more than
1 hour before or after cooking. Room temperature
promotes the growth of harmful bacteria. Be sure that the
oven light is off because heat from the bulb will speed
harmful bacteria growth.
Oven Probe (Lower oven only)
NOTE: Only accessible through traditional and
convection cooking modes.
Monitors internal food temperature and turns the oven
off when the food reaches the programmed temperature.
Insert the probe, press the desired cooking mode, and
program the probe temperature. See the Cooking Modes
Section for more information. The probe can only be used
with Bake, Convection Bake, and Convection Roast.
Settings
The Cooking Options and Settings pads open up more detailed menus in the display that allow access to
additional functions. For each you select the function in the display using the associated number pad. You
can exit at any time by pressing the Cooking Options or Settings pad again.
WiFi Connect/Remote Enable
Your oven is designed to provide you with two-way
communication between your appliance and smart
device. By using the WiFi Connect features, you will
be able to control essential oven operations such as
temperature settings, timers and cooking modes (such
as Air Fry) using your smartphone or tablet.*
Select Settings then Wifi - follow the instructions on your
oven display and phone app. It is necessary to turn on
WiFi before using Remote Enable on your oven.
Connecting your WiFi Connect Enabled Oven
What you will need
Your GE Appliances oven uses your existing home WiFi
network to communicate between the appliance and
your smart device. In order to setup your GE Appliances
oven, you will need to gather some information:
1. Each GE Appliances oven has a connected appliance
information label that includes an Appliance Network
Name and Password. These are the two important
details that you will need to connect to the appliance.
The label is typically located inside the door of the
oven or drawer. On some models it will also be
accessible through the settings menu on the control
screen.
2.
Have your smart phone or tablet ready with the ability
to access the internet and download apps.
3. You will need to know the password of your home
WiFi router. Have this password ready while you are
setting up your GE Appliances oven.
Connect your GE Appliances oven
1. On your smart phone or tablet visit
GEAppliances.com/connect to learn more about
connected appliance features and to download the
appropriate app.
2. Follow the app onscreen instructions to connect your
GE Appliances oven.
3. Once the process is complete, the connection light
located on your GE Appliances oven display will stay
on solid and the app will confirm you are connected.
FCC: ZKJ-WCATA001
Network: GE_XXXXXX_XXXX
Password: XXXXXXXX
PT. NO. 229C6272G001-0
IC: 10229A-WCATA001
MAC ID: XX - XX - XX - XX - XX - XX
Connected Appliance Information
Sample Label
USING THE RANGE:Options/Settings

49-2000866 Rev. 0 13
USING THE RANGE: Settings
Settings
Wifi Connect (cont.)
4. If the connection light does not turn on or is blinking,
follow the instructions on the app to reconnect. If
issues continue, please call the Connected Call
Center 1.866.626.2000 and ask for assistance
regarding oven wireless connectivity.
To connect additional smart devices, repeat steps 1 and 2.
Note that any changes or modifications to the remote
enable device installed on this oven that are not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.
REMOTE STARTING YOUR OVEN
To be able to start the oven remotely once connected
to WiFi, press Setting’s pad and select WiFi from the
menuontheVFDscreen.Select“TurnRemoteOn”
fromthemenuontheVFDscreenandRemoteSetting
is enabled. The icon will turn on. The oven can now
be remotely started with a connected device. The
icon must be lit to start the oven remotely. The icon
is not required to change the oven temperature while it
is running, set a timer or to turn the oven off from the
phone app while the icon shows it is Wifi Connected.
Remember to verify that the icon is lit if you wish to
start the oven remotely in the future.
NOTE: Foodsthatspoileasily—suchasmilk,eggs,fish,
stuffings,poultryandpork—shouldnotbeallowedto
sit for more than 1 hour before or after cooking. Room
temperature promotes the growth of harmful bacteria. Be
sure that the oven light is off because heat from the bulb
will speed harmful bacteria growth.
Clock
This setting sets the oven clock time. Press the Settings
pad and select Set Clock. Follow the instructions to set
the clock. This feature also specifies how the time of
day will be displayed. You can select a standard 12-hour
clock (12H), 24-hour military time display (24H), or no
clock displayed (Off). Press the Settings pad, select Set
Clock and select either 12/24 hr or On/Off.
Bluetooth
®
- Chef Connect
This is a pairing feature for use with other compatible
Chef Connect enabled products like an over-the-range
microwave oven or range hood. To pair those products to
the range Press the Settings pad and select Bluetooth
®
.
Select Pair and follow the corresponding instructions
included with the mating Chef Connect enabled product.
The range will cancel pairing mode after two minutes if
no mating device is detected. Select Remove to confirm
product is paired or to un-pair from range.
Auto Conv (Auto Conversion)
When using Convection Bake cooking, Auto Recipe
Conversion will automatically convert the regular baking
temperatures entered to convection bake cooking
temperatures when turned on. Note that this option
does not convert convection bake cooking times, it only
converts temperatures. This feature may be turned On or
Off. Select Settings and Auto Conversion, then follow
the prompts to turn this feature on or off.
Auto Off
This feature shuts the oven down after 12 hours of
continuous operation. It may be enabled or disabled.
Select Settings, More, and Auto Off to turn this feature
on or off.
Sound
You can adjust the volume and type of alert your
appliance uses. Select Settings, More, and Sound.
Follow prompts for making volume adjustments or for
changing between continuous and single alert tones. A
continuous setting will continue to sound a tone until a
button on the control is pressed. The oven tone volume
can be adjusted between several settings and off. The
control will sound the oven tone at the new volume level
each time the sound level is changed.
F/C (Fahrenheit or Celsius)
The oven control is set to use Fahrenheit temperatures
(F), but you can change it to use Celsius temperatures
(C). Select Settings, More, and F/C to alter between
temperature scales displayed.
Adjust the Oven temperature
This feature allows the oven cooking modes to be
adjustedupto35ºFhotterordownto35ºFcooler.Use
this feature if you believe your oven temperature is too
hot or too cold and wish to change it. This adjustment
affects Bake and Convection Bake modes. No other
cooking modes are affected. Select Settings and Oven
Adjust to add More Heat or Less Heat and then press
Save (for double ovens use the Upper Oven or Lower
Oven menu selection corresponding to the oven to be
adjusted).
Oven Info
To display the model number and software version on
your unit, select Settings, More, and Oven Info.

14 49-2000866 Rev. 0
TheSabbathmodefeaturecomplieswithstandardssetforthbyStarK.Someofthesestandardsthatwillbenoticed
by the consumer include the disabling of tones, disabling of oven lights, and delays of about 30 seconds to one
minute on display changes. Only continuous baking or timed baking is allowed in the Sabbath mode. Cooking in the
Sabbath mode is a two-step process, first the Sabbath mode must be set and then the bake mode must be set.
Setting the Sabbath Mode
Press the Settings pad, select Sabbath, and select
Turn on.Asinglebracket“]”willappearinthedisplay
indicating that the Sabbath mode is set. The clock will not
be displayed. Continuous bake or timed bake can now be
programmed.
Starting a Continuous Bake
1. Press the Bake pad. (For double ovens, this operates
the upper oven. If desiring to use Lower Oven, press
Lower Oven and then Bake.)
2. If the desired temperature is 350F, press Start/
Enter. If a different cooking temperature is desired,
use the 1 through 5 number pads to select a preset
cooking temperature, then press Start/Enter. Refer
to the graphic below to determine which pad sets the
desired cooking temperature.
Afteradelay,asecondbracket“][“willappearinthe
display indicating that the oven is baking.
Adjusting the Temperature
Press Bake (or press Lower Oven and then Bake for
lower oven in a double oven unit), use the 1 through
5 number pads to select a different preset cooking
temperature, and press Start/Enter.
Starting a Timed Bake
1. Press the Bake pad.
2. If the desired temperature is 350F, use the 6 through
0 number pads to select a cooking time. If a cooking
temperature other than 350F is desired, use the 1
through 5 number pads to select a preset cooking
temperature, then select the cooking time. Refer to
the graphic on this page to determine which pad sets
the desired cooking temperature and cooking time.
3. Press Start/Enter.
Afteradelay,asecondbracket“][“willappearinthe
display indicating that the oven is baking. When the cook
time expires, the display will change back to a single
bracket“]”indicatingthattheovenisnolongerbaking.
No tone will sound when the cook time is complete.
Exit the Sabbath Mode
Exiting the Sabbath mode should be done after the
Sabbath is over.
1. Press Cancel/Off to end any bake mode that may be
running.
2. Press and hold Settings pad until Sabbath Mode off
is displayed.
Sabbath Mode Power Outage Note
If a power outage occurs while the oven is in Sabbath
Mode, the unit will return to Sabbath Mode when power
is restored, however the oven will return to the off state
even if it was in the middle of a bake cycle when the
power outage occurred.
Sabbath Mode
Temperature (°F)
Time (hours)
200
325
2.5h
250
400
3h
4h
300
2h
3.5h
1 = 200° F, 2 = 250° F, 3 = 300° F, 4 = 325° F, 5 = 400° F
6 = 2 hours, 7 = 2.5 hours, 8 = 3 hours, 9 = 3.5 hours, 0 = 4 hours
USING THE RANGE: Sabbath Mode

49-2000866 Rev. 0 15
USING THE RANGE:OvenRacks/AluminumFoilandOvenLiners/Cookware
Recommended rack positions for various types of foods
are provided in the Oven Cooking Guide. Adjusting
rack position is one way to impact cooking results. For
example, if you would prefer darker tops on cakes,
muffins, or cookies, try moving food one rack position
higher. If you find foods are too brown on top try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is at least 1½" between pans to allow
sufficient space for air to flow.
To avoid possible burns, place the racks in the desired
position before you turn the oven on.
Oven Racks
Cookware
CAUTION
Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foil may be used to catch spills by placing a sheet on a lower rack, several inches below the food. Do not use more
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Aluminum Foil and Oven Liners
The number of rack positions may vary by model.
Cooking Modes
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Oven Cooking Guide section for rack position and other recommendations for specific modes and foods.
Baking and Roasting Modes
Select a mode for baking and roasting based on the
type and quantity of food you are preparing. When
preparing baked goods such as cakes, cookies, and
pastries always preheat the oven first. Follow recipe
recommendations for food placement. If no guidelines
are provided, center food in the oven.
Traditional Bake
The Bake mode is for baking and roasting. When preparing
baked goods such as cakes, cookies, and pastries, always
preheat the oven first. To use this mode press the Bake
pad, enter a temperature, and then press Start.
Convection Bake
This mode uses air movement from the convection fan
to enhance cooking evenness. Your oven is equipped
with Auto Recipe Conversion, so it is not necessary to
adjust the temperature when using this mode. Always
preheat when using this mode. Baking time might be
slightly longer for multiple racks than what would be
expected for a single rack. To use this mode press the
Convection Bake pad, enter a temperature, and then
press Start.
Cookware Guidelines
The material, finish, and size of cookware affect baking
performance.
Dark, coated and dull pans absorb heat more readily
than light, shiny pans. Pans that absorb heat more
readily can result in a browner, crisper, and thicker crust.
If using dark and coated cookware check food earlier
than minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25º F next time.
Shiny pans can produce more evenly cooked baked
goods such as cakes and cookies.
Glass and ceramic pans heat slowly but retain heat well.
These types of pans work well for dishes such as pies
and custards.
Air insulated pans heat slowly and can reduce bottom
browning.
Keepcookwarecleantopromoteevenheating.
Stoneware heats slowly and retains heat well. It is
recommended to preheat this type of cookware if
possible. Additional cook time may be required.
Cookware used in broil modes and air fry must be broil-
safe.

16 49-2000866 Rev. 0
Convection Roast
The Convection Roast mode is intended for roasting
whole cuts of meat on a single rack. This mode uses air
movement from the convection fan to improve browning
and reduce cooking time. Check food earlier than the
recipe suggested time when using this mode. To use
this mode press the Convection Roast pad, enter a
temperature, and then press Start.
Use WiFi connect to enable this feature.
Air Fry
Air Fry is a special, no-preheat, cooking mode that is
designed to produce foods with a crispier exterior than
traditional oven cooking. The Air Fry mode is intended
for single rack cooking only. Select Air Fry, then input
the desired set temperature and press Start. The
temperature can be set between 300°F and 500°F.
Preheating is not recommended for this mode. Follow
traditional oven recipe or package guidelines for set
temperatures and cook times; adjust cook time to
achieve your desired crispness. Additional guidelines
for using this mode can be found in the Air Fry Cooking
Guide.
Use WiFi connect to enable this feature.
Broiling Modes
Always broil with the oven door closed. Monitor food
closelywhilebroiling.Usecautionwhenbroiling;placing
food closer to the broil element increases smoking,
spattering, and the possibility of fats igniting. It is not
necessary to preheat when using the Broil modes.
Broil Hi
The Broil Hi mode uses intense heat from the upper
elementtosearfoods.UseBroilHiforthinnercuts
ofmeatand/orwhenyouwouldliketohaveaseared
surface and rare interior. To use this mode press the
Broil pad once and then press Start.
Broil Lo
The Broil Lo mode uses less intense heat from the upper
element to cook food thoroughly while also browning
thesurface.UseBroilLoforthickercutsofmeatand/or
foods that you would like cooked all the way through. To
use this mode press the Broil pad twice and then press
Start.
Warm
Warm modes are designed to keep hot, cooked foods
hot. Cover foods that should remain moist and do
not cover foods that should be crisp. Preheating is
not required. Do not use warm to heat cold food. It is
recommended that food not be kept warm for more than
2 hours. To use this mode, press the Warm pad then
press Start. The control display will show the oven is set
to Bake at 170ºF.
Frozen - Snacks
The Frozen Snacks modes are designed to cook frozen
foods such as potato nuggets, French fries, and similar
frozen snacks and appetizers. Most foods will cook
within package recommended time. Adjust cooking time
according to individual preferences.
UseFrozenSnacksSinglewhencookingfrozensnacks
on a single rack. This mode does not require preheating
the oven. Food should be placed in the oven before or
immediately upon starting this mode.
UseFrozenSnacksMultiwhencookingfrozensnacks
on two racks simultaneously. This mode includes a
preheating cycle to prepare the oven for multi-rack
baking. Press Options and select Frozen then follow any
display prompts to access this mode.
Use WiFi connect to enable this feature.
Frozen - Pizza
The Frozen Pizza modes are designed to cook
frozen pizzas. Most pizzas will cook within package
recommended times. Adjust cooking time according to
individual preferences.
UseFrozenPizzaSinglewhencookingonasinglerack.
This mode does not require preheating the oven. Food
should be placed in the oven before or immediately upon
starting this mode.
UseFrozenPizzaMultiwhencookingontworacks
simultaneously. This mode includes a preheating cycle
to prepare the oven for multi-rack baking. Press Options
and select Frozen then follow any display prompts to
access this mode.
Use WiFi connect to enable this feature.
Baked Goods
The Baked Goods mode is designed for cooking cakes,
breads, cookies, and similar foods on a single rack. This
mode is designed to provide lighter top browning and
better volume. Some foods may require slightly longer
cook times relative to when cooked in the traditional bake
mode. Press Options and select Baked Goods than
follow any display prompts to access this mode.
Use WiFi connect to enable this feature.
Proof
Proof mode maintains a warm environment for rising
yeast-leavened dough move this to the end of the Proof
section.
If the oven is too warm, Proof mode will not operate and
the display will show "Oven too hot for Proof".
For best results, cover the dough while proofing and
check early to avoid over-proofing.
CAUTION
Do not use the Proof mode for warming
food or keeping food hot. The proofing oven temperature
is not hot enough to hold foods at safe temperatures.
Cooking Modes
USING THE RANGE: Cooking Modes

49-2000866 Rev. 0 17
Internal food temperature is frequently used as an
indicator of doneness, especially for roasts and poultry.
The Probe mode monitors the internal food temperature
and turns the oven off when the internal food
temperature reaches the programmed temperature.
Always check the temperature at multiple locations in
the food with a food thermometer after cooking to ensure
that all portions of the food have reached the minimum
safe internal temperature for that food.
Proper Probe Placement
After preparing the meat and placing it on the cooking
pan follow these instructions for proper probe placement.
■ Inserttheprobeintothefood,sothatthetipofthe
probe will rest in the center of the thickest part of
the food. For best performance the probe should
be fully inserted into the food. If the probe is not
located properly, it may not accurately measure the
temperature of the coolest portion of the food. Some
foods, particularly small items, are not well suited for
cooking with the probe due to their shape or size.
■ Theprobeshouldnottouchbone,fatorgristle.
■ Forwholepoultryinserttheprobeintothethickest
part of the breast.
■ Forbonelessroasts,inserttheprobeintothecenter
of the roast.
■ Forbone-inhamorlamb,inserttheprobeintothe
center of the lowest large muscle or joint.
■ Forcasserolesordishessuchasmeatloaf,insertthe
probe into the center of the dish.
■ Forfish,inserttheprobefromjustabovethegillinto
the meatiest area, parallel to the backbone.
Probe Usage
The temperature probe can only be used with Bake,
Convection Bake, and Convection Roast
To use the probe with preheating:
1. Press the desired cook mode (Bake, Convection
Bake, or Convection Roast) pad and enter the
desired cooking temperature with the number pads.
2. Insert the probe into the food (see Proper Probe
Placement).
3. Once the oven is preheated, place the food in the
oven and connect the probe to the probe outlet,
makingsureitisfullyinserted.Usecaution,theoven
walls and probe outlet are hot.
4. When the probe is connected, the display will prompt
you to enter the desired food temperature. The
maximum internal food temperature that you can set
is 200° F.
To use the probe without preheating:
1. Insert the probe into the food (see Proper Probe
Placement).
2. Place the food in the oven and connect the probe into
the probe outlet in the oven.
3. Press the Cook Mode pad (Traditional Bake,
Convection Bake, or Convection Roast) and enter
the desired cooking temperature with the number
pads. Press Options and select Probe then follow
the display prompts to enter the desired food
temperature.
Probe Care Guidelines
■ Useofprobesotherthantheoneprovidedwiththis
product may result in damage to the probe outlet.
■ Usethehandlesoftheprobeandplugwheninserting
and removing them from the meat and outlet
■ Toavoiddamagingyourprobe,donotusetongsto
pull on the cable when removing it.
■ Toavoidbreakingtheprobe,makesurefoodis
completely defrosted before inserting the probe.
■ Topreventpossibleburns,donotunplugtheprobe
from the outlet until the oven has cooled.
■ Neverleavetheprobeinsidetheovenduringaselfor
steam clean cycle.
■ Donotstoretheprobeintheoven.
Probe (Lower oven only)
WARNING
Consuming undercooked food can result in foodborne illness. Use probe according to
the following instructions to ensure all portions of the food reach minimum safe cooking temperatures.
Recommendations for minimum safe food temperatures can be found at foodsafety.gov or IsItDoneYet.gov.
USING THE RANGE: Probe

18 49-2000866 Rev. 0
FOOD TYPE
RECOMMENDED
MODE(S)
OVEN
(Upper / Lower)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer Cakes, sheet cakes,
bundt cakes, muffins, quick
breads on a Single Rack
Bake
Upper
Lower
1
3
Useshinycookware.
Baked Goods Lower 3
Layer cakes* on Multiple
Racks
Bake
Convection Bake
Lower 2 and 4
Ensure adequate airflow
(see illustration below).
Chiffon cakes (angel food) Baked Goods Lower 1 Useshinycookware.
Cookies, biscuits, scones on
a Single Rack
Bake
Upper
Lower
1
3
Useshinycookware.
Baked Goods Lower 3
Cookies, biscuits, scones on
Multiple Racks
Convection Bake Lower 2 and 4 Ensure adequate airflow.
Yeast Breads
Proof
Upper
Lower
1
3
Cover dough loosely
Bake
Upper
Lower
1
3
Baked Goods Lower 3
Beef & Pork
Hamburgers Broil High Lower 6
Useabroilpan;movefooddownformore
doneness/lesssearing.Watchfoodcloselywhen
broiling. For best performance center food below
the broil heating element
Steaks & Chops Broil High Lower 5 or 6
Useabroilpan;movefooddownformore
doneness/lesssearing.Watchfoodcloselywhen
broiling. For best performance center food below
the broil heating element
Roasts
Bake
Convection Roast
Lower 2 or 3
Usealowsidedpansuchasabroilpan.
Preheating is not necessary
Poultry
Whole chicken
Bake
Convection Roast
Lower 2 or 3 Usealowsidedpansuchasabroilpan.
Bone-in chicken breasts,
legs, thighs
Broil Low
Bake
Upper
Lower
1
3
If breaded or coated in sauce avoid Broil Hi modes.
Broil skin side down first. Watch food closely when
broiling. For best performance when broiling,
center food below the broil heating element.
Boneless chicken breasts
Broil Low
Bake
Upper
Lower
1
3
If breaded or coated in sauce avoid Broil Hi modes.
Broil skin side down first. Watch food closely when
broiling. For best performance when broiling,
center food below the broil heating element
Whole turkey
Bake
Convection Roast
Lower 1 Usealowsidedpansuchasabroilpan.
Turkey Breast
Bake
Convection Roast
Lower 2 or 3 Usealowsidedpansuchasabroilpan.
Fish Broil Low Lower
6(1/2thickorless)
5(>1/2inch)
Watch food closely when broiling. For best performance
center food below the broil heating element.
Casseroles Bake
Upper
Lower
1
3 or 4
Frozen Convenience Foods
Pizza on a single rack Frozen Pizza Single Lower 3 Do not preheat.
Pizza on multiple racks Frozen Pizza Multi Lower 2 and 4
Stagger pizzas left to right, do not place directly
over each other
Potato products, chicken
nuggets, appetizers on a
single rack
Frozen Snacks Single
Upper
Lower
1
4
Donotpreheat.Usedarkcookwareformore
browning/crisping;useshinycookwareforless
browning.
Potato products, chicken
nuggets, appetizers on
multiple racks
Frozen Snacks Multi Lower 2 and 4
Usedarkcookwareformorebrowning/crisping;
use shiny cookware for less browning.
*When baking four cake layers at a time, use racks
2 and 4.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov.Useafoodthermometertotake
food temperatures.
Oven Cooking Guide
Baking four cake layers at a time
Rear Placement
Front Placement
USING THE RANGE: Oven Cooking Guide

49-2000866 Rev. 0 19
USING THE RANGE: Air Fry Cooking Guide
Air Fry is a special, no-preheat, cooking mode that
is designed to produce foods with a crispier exterior
than traditional oven cooking. Select Air Fry, then
input the desired set temperature and press Start. The
temperature can be set between 300°F and 500°F.
Air Fry Cookware Guidelines
• Only use broil safe cookware when using Air Fry mode.
• A dark sheet pan is recommended. A dark pan
promotes better browning and crisping.
• Oven baking baskets and baking grids can also be
used. A sheet pan should be placed on the rack below
the foods to catch any drippings when using a baking
basket.
General Tips for Air Fry Mode
• The Air Fry mode is designed for cooking on a single
rack.
• The Air Fry mode is designed to be used without
preheating.
•Rackposition4isrecommendedformostfoods.Use
rack position 3 for thicker foods.
• Foods may cook faster than expected if the oven is
already hot when food is placed in the oven.
• When air frying foods with sauce, it is recommended to
apply the sauce at the end of cooking.
• If foods are browning too quickly, try a lower rack
position or lower oven set temperature.
• For packaged foods, use traditional oven cooking
instructions for set temperature and expected cook
time.
• It is not necessary to flip or stir food during cooking
• Arrange food in a single layer on the pan, do not
overload the pan.
• Always check internal food temperature to confirm
minimum safe temperatures have been reached.
Minimum safe food temperatures can be found on
packages and at IsItDoneYet.gov.
FOOD TYPE
RECOMMENDED
RACK POSITION(S)
RECOMMENDED
SET TEMPERATURES (F°)
RECOMMENDED
COOK TIME (MIN) NOTES
Fresh boneless fish or
poultry pieces, breaded such
as nuggets, tenders, fillets
4 375-400 15-30
Userlowersettemperaturesforlargerpieces.
Useshinycookware.
Fresh bone in
chicken wings
4 375-400 25-40
Salt wings or coat in a dry rub, if using sauce
apply after cooking or toward the end of cooking
Fresh bone in chicken
drumsticks or thighs
3 or 4 375-400 30-55 Userlowersettemperaturesforlargerpieces.
Fresh French fries,
thin (< ½ inch)
4 400-425 15-30
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Fresh French fries,
thick (> ½ inch)
3 or 4 375-400 20-35
Parchment paper is recommended when
preparing fresh French fries. For crispier fries,
toss fries in corn starch or rice flour before
cooking.
Frozen packaged
foods
3 or 4
(use rack position 3 for
thicker foods)
Usetraditionaloven(notAirFry)cookinginstructionsasaguidelineforsettemperatureandcooktime.Additional
cook time beyond recommended package time may be required for some foods. If oven is hot when starting, food
may cook faster than the minimum package time.
Primary recommended cookware
Alternate cookware options
Air Fry Cooking Guide

20 49-2000866 Rev. 0
Cleaning the Range – Exterior
A child or adult can tip the range and be killed.
Verify the anti-tip bracket has been properly installed
and engaged.
Ensure the anti-tip bracket is re-engaged when the range
is moved.
Do not operate the range without the anti-tip bracket in
place and engaged.
Failure to follow these instructions can result in death or
serious burns to children or adults.
Tip-Over Hazard
WARNING
WARNING
If your range is removed for cleaning, servicing or any reason, be sure the
anti-tip device is reengaged properly when the range is replaced. Failure to
take this precaution could result in tipping of the range and can result in death
or serious burns to children or adults.
Be sure all controls are off and all surfaces are cool before cleaning any part of the range.
Control Lockout
If desired, the touch pads may be deactivated before
cleaning.
See Lock Controls in the Oven Controls section in this
manual.
Clean up splatters with a damp cloth.
You may also use a glass cleaner.
Remove heavier soil with warm, soapy water. Do not use
abrasives of any kind.
Reactivate the touch pads after cleaning.
Control Panel
It’s a good idea to wipe the control panel after each use.
Clean with mild soap and water or vinegar and water,
rinse with clean water and polish dry with a soft cloth.
Do not use abrasive cleansers, strong liquid cleansers,
plastic scouring pads or oven cleaners on the control
panel—theywilldamagethefinish,includingBlack
Stainless Steel.
Oven Exterior
Do not use oven cleaners, abrasive cleansers, strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the exterior of the oven. Clean with
a mild soap and water or vinegar and water solution.
Rinse with clean water and dry with a soft cloth. When
cleaning surfaces, make sure that they are at room
temperature and not in direct sunlight.
If stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up immediately. Let hot surfaces
cool, then clean and rinse.
Painted Surfaces, Black Stainless Steel, and Fingerprint Resistant Stainless Steel
Painted surfaces include the sides of the range and the
door, top of control panel and the drawer front. Clean
these with soap and water or a vinegar and water solution.
Do not use commercial oven cleaners, cleaning
powders, steel wool or harsh abrasives on any painted
surface, including Black Stainless Steel.
Stainless Steel (on some models)
Do not use a steel wool pad; it will scratch the surface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
CARE AND CLEANING: Cleaning the Range – Exterior

49-2000866 Rev. 0 21
CARE AND CLEANING: Cleaning the Range – Interior
Cleaning the Range – Interior
Racks
All racks can be washed with warm, soapy water.
Enameled (not shiny) racks can be left in the cavity
during self clean.
Racks may be more difficult to slide, especially after
a self-clean. Put some vegetable oil on a soft cloth or
paper towel and rub onto the left and right edges.
NOTE: Usingothercookingoilswillcauseadiscoloring
or a rust like color residue on the racks and cavity sides.
To clean this residue, use a soap and water or a vinegar
and water solution. Rinse with clean water and dry with a
soft cloth.
The interior of your new oven can be cleaned manually or by using Steam Clean or Self Clean modes.
Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and
should be wiped up immediately. Let hot surfaces cool, then clean and rinse.
Manual Cleaning
Do not use oven cleaners (unless certified for self-
cleaning oven), strong liquid cleansers, steel wool,
or scouring pads on the interior of the oven. For soils
on the oven bottom and other enameled surfaces,
use a gentle abrasive containing oxalic acid, such as
BarKeepersFriend®,withanon-scratchsponge.Take
care not to apply any abrasive cleaners or sponges to
the door glass, as it will scratch the reflective coating.
The oven interior and door glass may be cleaned using
a soft cloth with a mild soap and water, or vinegar and
water solution. After cleaning, rinse with clean water and
dry with a soft cloth.
Self Clean Mode
Read Self-Cleaning Oven Safety Instructions at the
beginning of this manual before using the Self Clean
Mode. Self Clean uses very high temperatures to clean
the oven interior. For a moderately soiled oven, run a
3 hour self-clean cycle. For a heavily soiled oven, run
a 5 hour self-clean cycle. Only self-clean (black) racks
and grates may remain in the oven during the self-clean
cycle. All other items, including nickel plated (silver) racks,
should be removed. If nickel plated (silver) racks are left
in the oven during a self-clean cycle, the racks will tarnish.
If either type of rack is left in the oven during a self-clean
cycle, the rack may become difficult to slide. See the
Oven Racks section for instructions on how to improve.
IMPORTANT: The health of some birds is extremely
sensitive to the fumes given off during the self-cleaning
cycle of any range. Move birds to another well-
ventilated room.
To use the Self Clean feature:
1. Start with the oven at room temperature.
2. Wipe excess grease and soils from the oven and
interior door.
3. Remove all items other than self-clean (black)
racks and grates, if desired. See Cleaning the
Cooktop to determine if your grates may be self-
cleaned and for important details regarding grate
placement.
4. Close the door.
5. Press Upper Oven or Lower Oven, press the
Clean pad, select Self Clean and then press
Start/Enter.
You cannot open the door during the self-clean cycle.
The door will remain locked after the self-clean cycle until
the oven cools below the unlocking temperature. At the
end of the self-clean cycle, allow the oven to cool and
wipe any ash out of the oven.
To Stop a Self-Clean Cycle
PresstheCancel/Offpad.Waituntiltheovenhascooled
below the locking temperature to unlatch the door. You
will not be able to open the door right away unless the
oven has cooled below the locking temperature.
The surface units are automatically disabled during the
self-clean cycle. Make sure that all surface unit controls
are turned off at all times during the self-clean cycle.
Wait until the self-clean cycle is finished to set and use
the surface units.
Steam Clean Mode
The Steam Clean feature is for cleaning light soil from
your oven at a lower temperature than Self Clean.
To use the Steam Clean feature:
1. Start with the oven at room temperature.
2. Wipe excess grease and soils from the oven.
3. Pour one cup of water onto the bottom of the oven.
4. Close the door.
5. Press Upper Oven or Lower Oven, press the
Clean pad, select Steam Clean and then press
Start/Enter.
You cannot open the door during the 30 minute Steam
Clean cycle. At the end of the Steam Clean cycle, soak
up the remaining water, and wipe the moisture-softened
soil from the oven walls and door.

22 49-2000866 Rev. 0
To maintain and protect the surface of your glass cooktop,
follow these steps:
1. Before using the cooktop for the first time, clean it
with a ceramic cooktop cleaner. This helps protect the
top and makes cleanup easier.
2. Regular use of ceramic cooktop cleaner will help keep
the cooktop looking new.
3. Shake the cleaning cream well. Apply a few drops of
ceramic cooktop cleaner directly to the cooktop.
4. Useapapertowelornon-scratchcleaningpadfor
ceramic cooktops to clean the entire cooktop surface.
5. Useadryclothorpapertoweltoremoveallcleaning
residue. No need to rinse..
NOTE: It is very important that you DO NOT heat the
cooktop until it has been cleaned thoroughly.
Burned-On Residue
NOTE: DAMAGE to your glass surface may occur if you
use scrub pads other than those recommended.
1. Allow the cooktop to cool.
2. Spread a few drops of ceramic cooktop cleaner on
the entire burned residue area.
3. Usinganon-scratchcleaningpadforceramic
cooktops, rub the residue area, applying pressure as
needed.
4. If any residue remains, repeat the steps listed above
as needed.
5. For additional protection, after all residue has been
removed, polish the entire surface with ceramic
cooktop cleaner and a paper towel.
Heavy, Burned-On Residue
1. Allow the cooktop to cool.
2. Useasingle-edgerazorbladescraperatapproximately
a 45° angle against the glass surface and scrape the
soil. It will be necessary to apply pressure to the razor
scraper in order to remove the residue.
3. After scraping with the razor scraper, spread a few drops
of ceramic cooktop cleaner on the entire burned residue
area.Useanon-scratchcleaningpadtoremoveany
remaining residue.
4. For additional protection, after all residue has been
removed, polish the entire surface with ceramic
cooktop cleaner and a paper towel.
Cleaning the Glass Cooktop
Cleaning the Range – Interior
Oven Heating Elements
Do not clean the bake element or the broil element. Any
soil will burn off when the elements are heated.
The bake element is not exposed and is under the oven
floor. Clean the oven floor with warm, soapy water.
Wipe up heavy soil on the oven bottom.
Clean your cooktop after each
spill.Useaceramiccooktop
cleaner.
Ceramic
Cooktop
Cleaner
Useanon-scratchcleaningpadfor
Ceramic Cooktops.
The ceramic cooktop scraper and all recommended supplies
are available through our Parts Center. See the Accessories
and Consumer Support sections at the end of this manual.
NOTE: Do not use a dull or nicked blade.
CARE AND CLEANING:CleaningtheRange-Interior/GlassCooktop

49-2000866 Rev. 0 23
CARE AND CLEANING: CleaningtheGlassCooktop/Probe
Metal Marks and Scratches
1. Be careful not to slide pots and pans across your
cooktop. It will leave metal markings on the cooktop
surface.
These marks are removable using the ceramic
cooktop cleaner with a non-scratch cleaning pad for
ceramic cooktops.
2. If pots with a thin overlay of aluminum or copper
are allowed to boil dry, the overlay may leave black
discoloration on the cooktop.
This should be removed immediately before heating
again or the discoloration may be permanent.
NOTE: Carefully check the bottom of pans for roughness
that would scratch the cooktop.
Damage from Sugary Spills and Melted Plastic
Special care should be taken when removing hot substances to avoid permanent damage of the glass surface.
Sugary spillovers (such as jellies, fudge, candy, syrups) or melted plastics can cause pitting of the surface of your
cooktop (not covered by the warranty) unless the spill is removed while still hot. Special care should be taken when
removing hot substances.
Be sure to use a new, sharp razor scraper.
Do not use a dull or nicked blade.
1. Turn off all surface units. Remove hot pans.
2. Wearing an oven mitt:
a. Useasingle-edgerazorbladescrapertomove
the spill to a cool area on the cooktop.
b. Remove the spill with paper towels.
3. Any remaining spillover should be left until the surface
of the cooktop has cooled.
4. Don’t use the surface units again until all of the
residue has been completely removed.
NOTE: If pitting or indentation in the glass surface has
already occurred, the cooktop glass will have to be
replaced. In this case, service will be necessary.
Cleaning the Glass Cooktop (Cont.)
Probe
The temperature probe may be cleaned with soap and
water or a soap-filled scouring pad. Cool the temperature
probe before cleaning. Scour stubborn spots with a soap-
filled scouring pad, rinse and dry.
To order additional temperature probes, see the
Accessories and Consumer Support sections at the end
of this manual.
■ Do not immerse the temperature probe in water.
■ Do not store the temperature probe in the oven.
■ Do not leave the temperature probe inside the oven
during a self or steam clean cycle.

24 49-2000866 Rev. 0
WARNING
SHOCK OR BURN HAZARD: Before replacing oven light bulb, disconnect the electrical power to the
range at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn.
CAUTION
BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with
bare hands or a damp cloth can cause burns.
Oven Light Replacement
To remove:
1.Turntheglasscovercounterclockwise1/4turnuntil
the tabs of the glass cover clear the grooves of the
socket. Wearing latex gloves may offer a better grip.
2.Usingglovesoradrycloth,removethebulbbypulling
it straight out.
To replace:
1.Useanew120/130-volthalogenbulb,nottoexceed
50 watts. Replace the bulb with the same type of bulb
that was removed. Be sure the replacement bulb is
rated 120 volts or 130 volts (NOT 12 volts).
2.Usingglovesoradrycloth,removethebulbfromits
packaging. Do not touch the bulb with bare fingers. Oil
from skin will damage the bulb and shorten its life.
3. Push the bulb straight into the receptacle all the way.
4. Place the tabs of the glass cover into the grooves of
thesocket.Turntheglasscoverclockwise1/4turn.
For improved lighting inside the oven, clean the glass
cover frequently using a wet cloth. This should be
done when the oven is completely cool.
5. Reconnect electrical power to the oven.
Oven Light
Usegloves
or cloth
Receptacle
G9 Bulb
Socket
Tab
Glass cover
Receptacle
(on some models)
CARE AND CLEANING: Oven Doors

49-2000866 Rev. 0 25
CARE AND CLEANING: Oven Doors
Lift-Off Lower Oven Door
The door is very heavy. Be careful when removing and lifting the door.
Do not lift the door by the handle.
To remove the door:
1. Fully open the door.
2. Pull the hinge locks down toward the door frame, to
the unlocked position. A tool, such as a small flat-
blade screwdriver, may be required.
3. Firmly grasp both sides of the door at the top.
4. Close door to the door removal position. The door
should be open approximately 3" with no obstruction
above the door.
5. Lift door up and out until both hinge arms are clear of
the slots.
To replace the door:
1. Firmly grasp both sides of the door at the top.
2. Starting on the left side, with the door at the same
angle as the removal position, seat the indentation of
the hinge arm into the bottom edge of the hinge slot.
The notch in the hinge arm must be fully seated into
the bottom of the slot. Repeat for right side.
3. Fully open the door. If the door will not fully open, the
indentation is not seated correctly in the bottom edge
of the slot.
4. Push the hinge locks up against the front frame of the
oven cavity, to the locked position.
5. Close the oven door.
Removal position
Hinge lock
Slot
Pull hinge locks down to unlock
Push hinge locks up to lock
Hinge
lock
Hinge
arm
Indentation
Bottom
edge of
slot
Hinge arm
Oven Doors
Lift-Off Upper Oven Door (for double oven)
To remove the door:
1. Fully open the door.
2. Lift up on the hinge lock toward the oven frame until
they stop.
3. Close the door to 45 degrees (you will feel the door
stop). The hinge lock will contact the oven frame.
4. On both sides of the door, press down on the release
buttons on each hinge.
5. Lift door up until it is clear of the hinge.
6. Pull on hinge arms slightly to relieve pressure on the
locking tabs.
7. Push the hinge locks down onto the hinge.
8. Push the hinges in toward the unit so they are closed.
To replace the door:
1. Pull the hinges down away from the oven frame to
the fully open position.
2. Lift up on the hinge locks toward the oven frame until
they stop.
3. The hinges will release to the 45-degree position. The
hinge locks will contact the oven frame.
4. Slide the door back onto the hinges. Make sure the
buttons pop back out.
5. Fully open the door.
6. Push the hinge locks down onto the hinge.
7. Close the oven door.
Oven
frame
Door
frame
Release
buttons
Pull down
Push in

26 49-2000866 Rev. 0
Troubleshooting Tips ... Before you call for service
Save time and money! Review the charts on the following pages first and you may not need to call for service.
Problem Possible Cause What To Do
Surface units will not
maintain a rolling boil or
cooking is not fast enough
Improper cookware being used. Usepanswhichareflatandmatchthediameterofthe
surface unit selected.
In some areas, the power (voltage) may be low. Cover pan with a lid until desired heat is obtained.
Surface units do not work
properly
A fuse in your home may be blown or the circuit
breaker tripped.
Replace the fuse or reset the circuit breaker.
Cooktop controls improperly set. Check to see the correct control is set for the surface
unit you are using.
Surface unit stops glowing
when turned to a lower
setting
The unit is still on and hot. This is normal.
Scratches (may appear as
cracks) on cooktop glass
surface
Incorrect cleaning methods being used. Scratches are not removable. Tiny scratches will become
less visible in time as a result of cleaning.
Cookware with rough bottoms being used or coarse
particles (salt or sand) were between the cookware
and the surface of the cooktop. Cookware has been
slid across the cooktop surface.
To avoid scratches, use the recommended cleaning
procedures. Make sure bottoms of cookware are clean
before use, and use cookware with smooth bottoms.
Areas of discoloration on
the cooktop
Food spillovers not cleaned before next use. See the Cleaning the glass cooktop section.
Hot surface on a model with a light-colored
cooktop.
This is normal. The surface may appear discolored when
it is hot. This is temporary and will disappear as the
glass cools.
Plastic melted to the
surface
Hot cooktop came into contact with plastic
placed on the hot cooktop.
SeetheGlasssurface—potentialforpermanentdamage
section in the Cleaning the glass cooktop section.
Pitting (or indentation) of
the cooktop
Hot sugar mixture spilled on the cooktop. Call a qualified technician for replacement.
My new oven doesn't
cook like my old one. Is
something wrong with the
temperature settings?
Your new oven has a different cooking system
from your old oven and therefore may cook
differently than your old oven.
For the first few uses, follow your recipe times and
temperatures carefully. If you still think your new oven
is too hot or too cold, you can adjust the temperature
yourself to meet your specific cooking preference.
NOTE: This adjustment affects Bake, and Convection
Bake temperatures; it will not affect Convection Roast,
Broil or Clean.
Food does not bake
properly
Oven controls improperly set. See the Cooking Modes section.
Rack position is incorrect or rack is not level. See the Cooking Modes section and Oven Cooking
Guide..
Incorrect cookware or cookware of improper size
being used.
See the Cookware section.
The probe is plugged into the outlet in the oven. Unplugandremovetheprobefromtheoven.
Oven temperature needs adjustment. See the Special Features section.
Ingredient substitution Substituting ingredients can change the recipe outcome.
Frequent cycling off and
on of surface units
Improper cookware being used. Useonlyflatcookwaretominimizecycling.
TROUBLESHOOTING TIPS

49-2000866 Rev. 0 27
TROUBLESHOOTING TIPS
Problem Possible Cause What To Do
Food does not broil properly Oven controls improperly set. Make sure you select the appropriate broil mode.
Improper rack position being used. See Oven Cooking Guide for rack location suggestions.
Food being cooked in a hot pan. Make sure cookware is cool.
Cookware not suited for broiling. Useapanspecificallydesignedforbroiling.
Aluminum foil used on the broiling pan
and grid has not been fitted properly and
slit as recommended.
If using aluminum foil conform to pan slits.
In some areas the power (voltage) may
be low.
Preheat the broil element for 10 minutes.
Oven temperature too hot or
too cold
Oven temperature needs adjustment. See the Special Features section.
Oven does not work or
appears not to work
Plug on range is not completely inserted
in the electrical outlet.
Make sure electrical plug is plugged into a live, properly
grounded outlet.
A fuse in your home may be blown or
the circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Oven controls improperly set. SeetheUsingtheOvensection.
Oven is in Sabbath Mode. Verify,thattheovenisnotinSabbathMode.SeetheSpecial
Features section.
“Crackling” or “popping”
sound
This is the sound of the metal heating
and cooling during both the cooking and
cleaning functions.
This is normal.
Why is my range making a
"clicking" noise when using
my oven?
Your range cycles the heating elements
by turning relays on and off to maintain
the oven temperature.
This is normal.
Clock and timer do not work A fuse in your home may be blown or
the circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Plug on range is not completely inserted
in the electrical outlet.
Make sure electrical plug is plugged into a live, properly
grounded outlet.
Oven controls improperly set. See the Oven Control section.
Oven door is crooked The door is out of position. Because the oven door is removable, it sometimes gets out of
position during installation. To straighten the door, re-install the
door. See the "Lift-Off Oven Door" instructions in the "Care and
Cleaning" section.
Oven light does not work Light bulb is loose or defective. Tighten or replace bulb.
Pad operating light is broken. Call for service.
Oven will not self-clean The temperature is too high to set a self-
clean operation.
Allow the oven to cool and reset the controls.
Oven controls improperly set. See the Cleaning the Oven section.
The probe is plugged into the outlet in
the oven.
Remove the probe from the oven.
Oven will not steam clean. Display flashes HOT.
Allow the oven to cool to room temperature and reset the controls.
Oven controls improperly set. SeetheUsingSteamCleansection.
Oven door is not closed. Make sure you close the door to start steam clean cycle.
Excessive smoking during
clean cycle
Excessive soil or grease. Press the Cancel/Off pad. Open the windows to rid the room
of smoke. Wait until the LOCKED light goes off. Wipe up the
excess soil and reset the clean cycle.
Troubleshooting Tips ... Before you call for service

28 49-2000866 Rev. 0
Problem Possible Cause What To Do
Excessive smoking during
broiling
Food too close to broil element. Lower the rack position of the food.
Oven door will not open
after a clean cycle
Oven too hot. Allow the oven to cool below locking temperature.
Oven not clean after a clean
cycle
Oven controls improperly set. See the Cleaning the Oven section.
Oven was heavily soiled. Clean up heavy spillovers before starting the clean cycle. Heavily
soiled ovens may need to self-clean again or for a longer period
of time.
"DOOR LOCKING" flashes
in the display
The self-clean cycle has been selected but
the door is not closed.
Close the oven door.
DOOR LOCKED is on when
you want to cook
The oven door is locked because the
temperature inside the oven has not
dropped below the locking temperature.
Press the Cancel/Off pad. Allow the oven to cool.
“F— and a number or
letter” flash in the display
You have a function error code. Press the Cancel/Off pad. Allow the oven to cool for one hour.
Put the oven back into operation.
If the function code repeats. Disconnect all power to the oven for at least 30 seconds and
then reconnect power. If the function error code repeats, call for
service.
Display goes blank A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
The clock is turned off. See the Special features section.
Oven is in Sabbath Mode. VerifythattheovenisnotinSabbathMode.SeetheSpecial
Features section.
Oven or cooktop will not
stay set.
Function error. Disconnect all power for at least 30 seconds and then reconnect
power. If repeating, call for service.
Power outage, clock flashes Power outage or surge Reset the clock. If the oven was in use, you must reset it by
pressing the Cancel/Off pad, setting the clock and resetting any
cooking function.
“Burning” or “oily” odor
emitting from the vent
This is normal in a new oven and will
disappear in time.
To speed the process, set a self-clean cycle for a minimum of 3
hours. See the Cleaning the Oven section.
Strong odor An odor from the insulation around the
inside of the oven is normal for the first few
times the oven is used.
This is temporary and will go away after several uses or a self-
clean cycle.
Fan noise A convection fan may automatically turn
on and off.
This is normal. The fan is designed to operate intermittently to
maximize cooking evenness. The convection fan will operate
during preheat of the bake cycle. The fan will turn off after the
oven is heated to the set temperature. This is normal.
A cooling fan may automatically turn on
and off.
This is normal on some models. The cooling fan will turn off and
on to cool internal parts. It may run after the oven is turned off.
My oven door glass appears
to be "tinted" or have a
"rainbow" color. Is this
defective?
No. The inner oven glass is coated with
a heat barrier to reflect the heat back into
the oven to prevent heat loss and keep the
outer door cool while baking.
Thisisnormal.Undercertainlightorangles,youmayseethistint
or rainbow color.
Sometimes the oven takes
longer to preheat to the
same temperature
Cookware or food in oven. The cookware or food in the oven will cause the oven to take
longer to preheat. Remove items to reduce preheat time.
Number of racks in oven. Adding more racks to the oven will cause the oven to take longer
to preheat. Remove some racks.
Different cooking modes. The different cooking modes use different preheat methods to
heat the oven for the specific cooking mode. Some modes will
take longer than others (i.e. convection bake).
Display flashes Power failure. Reset the clock.
Troubleshooting Tips ... Before you call for service
TROUBLESHOOTING TIPS

49-2000866 Rev. 0 29
TROUBLESHOOTING TIPS
Troubleshooting Tips ... Before you call for service
Problem Possible Cause What To Do
Unable to set cook time or
delay time
You forgot to enter a cooking mode first. See the Options section
Oven racks are difficult to
slide
The shiny, silver-colored racks were
cleaned in a self-clean cycle.
Apply a small amount of vegetable oil to a paper towel and wipe
the edges of the oven racks with the paper towel. Do not spray
with Pam
®
or other lubricant sprays.
Drawer does not slide
smoothly or drags
The drawer is out of alignment. Fully extend the drawer and push it all the way in See the Care
and cleaning of the range section.
Drawer is over-loaded or load is
unbalanced.
Reduce weight. Redistribute drawer contents.
Steam from the vent When using the ovens, it is normal to see
steam coming out of the oven vents. As the
number of racks or amount of food being
cooked increases, the amount of visible
steam will increase.
This is normal.
Water remaining on oven
floor after Steam Clean cycle
This is normal. Remove any remaining water with a dry cloth or sponge.
Display prompts for Probe
Temperature
This is reminding you to enter a probe
temperature after plugging in the probe.
Enter a probe temperature.
Oven will not work remotely Router issues, no wireless signal, etc. For assistance with oven wireless network connectivity, please
call 1-800-220-6899.
Oven is not connected.
Remote enable is off Turn remote enable on (see Special Features section of this
manual)

30 49-2000866 Rev. 0
Staple your receipt here. Proof of the original purchase
date is needed to obtain service under the warranty.
GEAppliances.com
All warranty service is provided by our Factory Service Centers, or an authorized Customer Care
®
technician. To schedule
service online, visit us at GEAppliances.com/service, or call GE Appliances at 800.GE.CARES (800.432.2737). Please
have your serial number and your model number available when calling for service.
Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE Appliances factory
service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its
products by providing GE Appliances with information on your appliance. If you do not want your appliance data to be
sent to GE Appliances, please advise your technician not to submit the data to GE Appliances at the time of service.
What GE Appliances will not cover:
■ Service trips to your home to teach you how to use
the product.
■ Improperinstallation,deliveryormaintenance.
■ Failureoftheproductifitisabused,misused,
modified or used for other than the intended purpose
or used commercially.
■ Damagetotheglasscooktopcausedbyuseof
cleaners other than the recommended cleaning
creams and pads.
■ Damagetotheglasscooktopcausedbyhardenedspills
of sugary materials or melted plastic that are not cleaned
according to the directions in the Owner's Manual.
■ Replacementofhousefusesorresettingofcircuit
breakers.
■ Damagetotheproductcausedbyaccident,fire,
floods or acts of God.
■ Damagetofinish,suchassurfacerust,tarnish,orsmall
blemishes not reported within 48 hours of delivery.
■ Incidentalorconsequentialdamagecausedby
possible defects with this appliance.
■ Damagecausedafterdelivery.
■ Productnotaccessibletoproviderequiredservice.
■ Servicetorepairorreplacelightbulbs,exceptfor
LED lamps.
LIMITED WARRANTY
GE Appliances Electric Range Limited Warranty
EXCLUSION OF IMPLIED WARRANTIES
Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties,
including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or
the shortest period allowed by law.
This limited warranty is extended to the original purchaser and any succeeding owner for products purchased for
homeusewithintheUSA.IftheproductislocatedinanareawhereservicebyaGEAppliancesAuthorizedServicer
is not available, you may be responsible for a trip charge or you may be required to bring the product to an Authorized
GE Appliances Service location for service. In Alaska, the limited warranty excludes the cost of shipping or service
calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This limited warranty
gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your
legal rights are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: GE Appliances, a Haier company
Louisville,KY40225
Extended Warranties: Purchase a GE Appliances extended warranty and learn about special discounts that are
available while your warranty is still in effect. You can purchase it online anytime at
GEAppliances.com/extended-warranty
or call 800.626.2224 during normal business hours. GE Appliances Service will still be there after your warranty expires.
For the period of GE Appliances will replace
One year
From the date
of the original
purchase
Any part of the range which fails due to a defect in materials or workmanship. During this
limited one-year warranty, GE Appliances will provide, free of charge, all labor and in-home
service to replace the defective part.

49-2000866 Rev. 0 31
ACCESSORIES
Looking For Something More?
GE Appliances offers a variety of accessories to
improve your cooking and maintenance experiences!
Refer to the Consumer Support page for phone numbers
and website information.
The following products and more are available:
Accessories
Accessories
SmallBroilerPan(8¾”x1¼”x13½“)
LargeBroilerPan(12¾”x1¼”x16½“)
XLBroilerPan(17”x1¼”x191/4“)
Parts
Oven racks
Oven elements
Light bulbs
Cleaning Supplies
CitruShine™ Stainless Steel Wipes
Stainless Steel Appliance Cleaner
Non-scratch Cleaning Pads for Ceramic Cooktops
Ceramic Cooktop Cleaner
Ceramic Cooktop Scraper
Kit(Kitincludescreamandcooktopscraper)
*Thelargebroilerpandoesnotfitin20”/24”ranges.
**TheXLbroilerpandoesnotfitin24”wallovens,27”drop-insor20”/24”range.
NOTE: Go to GE Appliances website to view recommended cleaners.

32 49-2000866 Rev. 0
PrintedintheUnitedStates
Consumer Support
CONSUMER SUPPORT
GE Appliances Website
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day
of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support
servicesdesignedforyourconvenience.IntheUS:GEAppliances.com
Register Your Appliance
Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also mail in
thepre-printedregistrationcardincludedinthepackingmaterial.IntheUS:GEAppliances.com/register
Schedule Service
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
yourconvenienceanydayoftheyear.IntheUS:GEAppliances.com/service
or call 800.432.2737 during normal business hours.
Extended Warranties
Purchase a GE Appliances extended warranty and learn about special discounts that are available while your
warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your
warrantyexpires.IntheUS:GEAppliances.com/extended-warranty
or call 800.626.2224 during normal business hours.
Remote Connectivity
For assistance with wireless network connectivity (for models with remote enable),
visit our website at GEAppliances.com/connect orcall800.220.6899intheUS.
Parts and Accessories
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes
(VISA,MasterCardandDiscovercardsareaccepted).Orderon-linetoday24hourseveryday.
IntheUS:GEApplianceparts.com or by phone at 877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing
generally should be referred to qualified service personnel. Caution must be exercised, since improper
servicing may cause unsafe operation.
Contact Us
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the
details including your phone number, or write to:
IntheUS:GeneralManager,CustomerRelations|GEAppliances,AppliancePark|Louisville,KY40225
GEAppliances.com/contact

