Frigidaire FPES3085KFE electric range

Product's Documents

Below are documents related to this product, you can read online or download:
User Manual Installation Instruction
  • Installation Instruction - (English) Download

User Manual

This is the main product document for model FPES3085KFE.

The file format is pdf, 44 pages, you can download this manual here .

background
www,frigidaire,com USA 1-800-944-9044 www,frigidaire,ca Canada :I.-800-265-8352
background
Product Registration
Register Your Product
ThePRODUCT
REGISTRATION CARD
should be filled in completely,
iii
signed and returned to
Electrolux Home Products.
Serial Plate Location
Please record your model and serial numbers
below for future reference,
Model Number:
Serial Number:
ii
Purchase Date:
ii
Si desea obtener una copia en espa_ol de este Manual
del Usuado, sfrvase escribir a la direcci6n que se
Congratulations on your purchase of a new appliance! At
Electrolux Home Products, we are very proud of our
product and are completely committed to providing you
with the best service possible. Your satisfaction is our
number one priority.
We know you'll enjoy your new appliance and Thank You
for choosing our product. We hope you consider us for
future purchases.
PLEASE CAREFULLY READ AND SAVE THESE
INSTRUCTIONS
This Use & Care Manual contains general operating
instructions for your appliance and feature information
for several models. Your product may not have all
the described features. The graphics shown are
representative. The graphics on your appliance may not
look exactly like those shown. These instructions are not
meant to cover every possible condition and situation
that may occur. Common sense and caution must be
practiced when installing, operating and maintaining any
appliance.
Please attach sales receipt here for future reference.
incluye a continuaci6n. Solicite la P/N 318205803E.
Spanish Use & Care Manual
Electrolux Home Products
P. O. Box 212378
© 2009 Electrolux Canada Corp,
All rights reserved
Printed in United States
background
Read all instructions before using this appliance.
Save these instructions for future reference.
DEFINITIONS
A This is the safety alert symbol. It is used to alert
you to potential personal injury hazards. Obey all safety
messages that follow this symbol to avoid possible injury
or death,
This symbol will help alert you to situations
that may cause serious bodily harm, death or
This symbol will help alert you to situations that
may cause bodily injury or property damage.
edition and local code requirements. Install only
per installation instructions provided in the literature
package for this range.
Ask your dealer to recommend a qualified technician
and an authorized repair service. Know how to
disconnect the electrical power to the appliance at the
circuit breaker or fuse box in case of an emergency.
User Servicing. Do not repair or replace any
part of the appliance unless specifically
recommended in the manuals. All other servicing
should be done only by a qualified technician to
reduce the risk of persona! injury and damage to the
appliance.
Never modify or alter the construction of an
appEance by removing leveling legs, panels, wire
covers, anti-tip brackets/screws, or any other
part of the product.
IMPORTANT indicates installation, operation or
maintenance information which is important but not
hazard-related.
Stepping, leaning, sitting or pulEng down on the
door or the drawer of this appliance can result
in serious injuries and also cause damage to the
appliance, Do not allow children to climb or play around
the appliance. The weight of a child on an open door may
causethe appliance to tip, resulting inserious burns or other
injury. An open drawer when hot may cause burns.
o All appliance can tip.
• Injury to persons could result.
• Install anti=tip bracketpacked with
your appliance.
• See Installation Instructions.
To reduce the risk of tipping, the
appliance must be secured by properly
installed anti=tip bracket provided
with the unit. Refer to the Installation
Instructions for proper anti=tip
bracket installation.
• Remove all tape and packaging wrap before using
the appliance. Destroy the carton and plastic
bags after unpacking the appliance. Never allow
children to play with packaging material. Do not remove
the wiring label and other literature attached to the
appliance. Do not remove model/serial number plate.
• Proper Installation. Be sure your appliance is
properly installed and grounded by a qualified
technician in accordance in the United States
with the National Electrical Code ANSI/NFPA No.
70=latest edition, and local code requirements,
and in Canada with CSA C22.1 PART l=latest
Do not use the oven or warm & serve drawer (if
Storage in or on Appliance. Flammable materials
should not be stored in an oven, near surface
burners or in the warm 8=serve drawer (if
equipped). This includes paper, plastic and cloth
items, such as cookbooks, plastic ware and towels, as
well as flammable liquids. Do not store explosives, such
as aerosol cans, on or near the appliance. Flammable
materials may explode and result in fire or property
damage.
Do not store items of interest to children in the
cabinets above the appliance. Children climbing on
the cooktop to reach items could be seriously injured.
• Do not leave children alone. Children should not
be left alone or unattended in the area where an
appliance is in use, They should never be allowed to
sit or stand on any part of the appliance.
background
• DO NOT TOUCH SURFACE UNITS, AREAS NEAR
THESE UNITS, OVEN HEATING ELEMENTS OR
INTERIOR SURFACES OF THE OVEN OR WARMER
DRAWER (if equipped). Both surface units and oven
heating elements may be hot even though they are
dark in color. Areas near surface units may become
hot enough to cause burns. During and after use, do
not touch, or let clothing or other flammable materials
touch these areas until they have had sufficient time
to cool. Among these areas are the cooktop, surfaces
facing the cooktop, the oven vent openings and
surfaces near these openings, oven door and window.
• Wear Proper Apparel. Loose=fitting or hanging
garments should never be worn while using the
appliance. Do not let clothing or other flammable
materials contact hot surfaces.
NEVER use your appliance as a space heater to
heat or warm the room.
• Do Not Use Water or Flour on Grease Fires.
Smother the fire with a pan lid, or use baking
soda, a dry chemical or foam=type extinguisher.
• When heating fat or grease, watch it closely, Fat
or grease may catch fire if allowed to become too hot.
• Use Only Dry Pot holders. Hoist or damp pot
holders on hot surfaces may result in burns from
steam, Do not let the pot holders touch hot surface
units. Do not use a towel or other bulky cloth instead of
a pot holder.
= Do Not Heat Unopened Food Containers. Buildup
of pressure may cause the container to burst and
result in injury.
• Remove the oven door from any unused
appliance if it is to be stored or discarded.
Do not attempt to operate the appliance during a
power failure. If the power fails, always turn off
the unit. If the unit is not turned off and the power
resumes, the appliance will not operate and an error
message will be displayed. Once the power resumes,
reset the clock and the oven function.
Electronic controllers can be damaged by cold
temperatures. When you use your appliance for
the first time, or if it has not been used for a long
period of time, make sure that it has been exposed
to a temperature above 00C/32°F for at least 3
hours before connecting it to the power supply.
IMPORTANT INSTRUCTIONS FOR USING
YOUR COOKTOP
• Know which knob controls each surface heating
unit. Place pan of food on the element before turning
it on, and turn the element off before removing the
pan.
• Use Proper Pan Size--This appliance is equipped with
one or more surface burners of different sizes. Select
utensils having flat bottoms large enough to cover the
surface unit. The use of undersized utensils wifl expose
a portion of surface heating unit to direct contact and
may result in ignition of clothing. Proper relationship of
utensil to the surface will also improve efficiency.
- Utensil Handles Should Be Turned Inward
and Should Not Extend Over Adjacent Surface
Units--To reduce the risk of burns, ignition of
flammable materials, and spillage due to unintentional
contact with the utensil. The handle of the utensil
should be positioned so that it is turned inward, and
does not extend over adjacent surface unit.
- Do not use Searing Grill on the cooktop--The
Searing grill is not designed for use on the cooktop.
Doing so may result in a fire.
- Never Leave Surface Units Unattended--Boilovers
cause smoking and greasy spillovers that may ignite, or
a pan that has boiled dry may melt.
- Protective Liners--Do not use aluminum foil to line
oven bottom or any other part of the appliance. Only
use aluminum as recommended for baking if used as a
cover placed on the food. Any other used of protective
liners or aluminum foil may result in a risk of electric
shock or fire or a short circuit.
• Glazed Cooking Utensils--Only certain types of glass,
glass/ceramic, ceramic, earthenware, or other glazed
utensils are suitable for cooktop service without breaking
due to the sudden change in temperature. Check the
manufacturer's recommendations for cooktop use.
- Do Not Use Decorative Surface Burner Covers.
If an element is accidentally turned on, the decorative
cover will become hot and possibly melt. Burns will
occur if the hot covers are touched. Damage may also
be done to the cooktop.
background
FOR GLASS COOKTOP ONLY
• Do Not Clean or Operate a Broken Cooktop-- If
cooktop should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
• Clean Cooktop Glass with Caution-- If a wet
sponge or cloth is used to wipe spills on a hot cooking
area, be careful to avoid a steam burn. Some cleaners
can produce harmful fumes if applied to a hot surface.
• Avoid Scratching the Cooktop Glass with Sharp
Objects,
IMPORTANT SAFETY INSTRUCTIONS FOR
USING YOUR OVEN
• Use Care When Opening Oven Door or Warm
8=Serve Drawer (if equipped)--Stand to the side
of the appliance when opening the door/drawer of a
hot appliance. Let hot air or steam escape before you
remove or replace food in the oven/drawer.
• Keep Oven Vent Ducts Unobstructed. The oven is
vented at the front above the oven door. Touching the
surfaces in this area when the oven is operating may
cause severe burns. Also, do not place plastic or heat-
sensitive items on or near the oven vent. These items
could melt or ignite.
NEVER cover any slots, holes or passages in
the oven bottom or cover an entire rack with
materials such as aluminum foil. Doing so blocks
air flow through the oven and may cause carbon
monoxide poisoning. Aluminum foil linings may trap
heat, causing a fire hazard.
• Placement of Oven/Warm & Serve Drawer (if
equipped) Racks. Always place oven/Warm & Serve
Drawer (if equipped) racks in desired location while
appliance is coo!. Remove all utensils from the rack
before removing rack. If rack must be moved while
oven is hot, use extreme caution. Use pot holders and
grasp the rack with both hands to reposition. Do not let
pot holders contact the hot oven element or interior of
the oven/Warm & Serve Drawer (if equipped).
- Do not use a broiler pan without its insert. Broiler
pan and grid allow dripping fat to drain and be kept
away from the high heat of the broiler.
- Do not cover the broiler grid or oven bottom
with aluminum foil, Exposed fat and grease could
ignite.
Do not touch a hot oven lightbulb with a damp
cloth.Doingso couldcause the bulbto break,
Disconnecttheapplianceor shutoffthe power to the
appliancebeforeremovingand replacingthe bulb.
IMPORTANT SAFETY INSTRUCTIONS FOR
CLEANING YOUR OVEN
• Clean the appliance regularly to keep all parts
free of grease that could catch fire. Exhaust fan
ventilation hoods and grease filters should be kept
clean. Do not allow grease to accumulate. Greasy
deposits in the fan could catch fire. Refer to the hood
manufacturer's instructions for cleaning.
• Cleaners/Aerosols--Always follow the manufacturer's
recommended directions for use. Be aware that excess
residue from cleaners and aerosols may ignite causing
damage and/or injury.
• Clean in the self-cleaning cycle only the parts of
the appliance listed in this Owner's Guide. Before
using the selFcleaning cycle of the appliance, remove
all utensils stored in the appliance.
• Do not clean the oven door gasket. The door
gasketisessentialfora good seal.Care shouldbe
taken notto rub,damage or move the gasket.
o Do not use oven cleaners. No oven cleaner or oven
liner protective coating of any kind should be used in or
around any part of the appliance.
• Remove oven racks. Oven racks color will change if
left in the oven during a self-cleaning cycle,
The health of some birds is extremely sensitive to the
fumes given off during the self-dean cycle of any wall
0yen: Move birds to another well ventilated room:...................................
The California Safe Drinking Water and Toxic
Enforcement Act requires the Governor of California
to publish a list of substances known to the state to
cause cancer, birth defects or other reproductive harm,
and requires businesses to warn customers of potential
exposure to such substances.
background
Your built=in range Features:
1, Electronic oven control with kitchen timer.
2. Left front element control.
3, Left rear element control.
4, Right rear element control.
5, Right front element control.
6, Keep warm zone control.
7, Element on indicator light.
8, Automatic oven door light switch.
9, Self=clean door latch.
10, Oven vent.
11, Broil element,
12. Self-cleaning oven interior,
13, Convection bake cooking system,
14, Oven interior light with removable cover.
15, Adjustable interior oven rack(s).
16, Large 1-piece oven door handle.
17, Full width oven door with window.
18, Storage drawer.
19, 6" single radiant element.
20, Keep warm radiant element.
21. 6" single radiant element.
22. 6"/9" double radiant element.
23, 12" single radiant element.
24, Ceramic glass cooktop.
25, Hot surface indicator light.
The features shown for your appliance may vary
according to model type & color,
iil _ _ _ _ _ _ _ _ _ _ _ _ _
i _i!i:iiii_ili_ii_i_iii!i_:ili_:_i___:/__:i_iiiii_i_i!__ii_ii::ii!iiiiii_i_i_i_ii_
background
Your built=in range Features:
1, Electronic oven control with kitchen timer.
2. Electronic element contro! digital displays.
3, Keep warm zone control.
4, Warm & serve drawer control.
5, Left front element contro!.
6, Left rear element contro!.
7. Right rear element control.
8, Right front element control.
9, Element on indicator light.
10, Cooktop on indicator light.
11, Automatic oven door light switch.
12. Self-clean door latch.
13, Oven vent.
14, Broil element,
15, Self-cleaning oven interior.
16, Convection bake cooking system,
17, Oven interior light with removable cover.
18, Adjustable interior oven rack(s).
19. Large 1-piece oven door handle,
20, Full width oven door with window.
21, Warm & serve drawer with large 1-piece handle.
22. 6" single radiant element.
23, Keep warm radiant element.
24, 6" single radiant element.
25. 6"/9" double radiant element.
26, 9"/12" double radiant element.
27, Ceramic glass cooktop.
The features shown for your appliance may vary
according to model type & color,
\
background
Your built=in range Features:
1, Electronic oven control with kitchen timer.
2. Left rear burner control.
3. Keep warm zone control.
4. Warm & serve drawer control.
5, Left front element control.
6. Left rear element control.
7. Right rear element control.
8, Right front element control.
9, Element on indicator light.
10, Cooktop on indicator light.
11, Automatic oven door light switch.
12. Self-clean door latch.
13. Oven vent.
14, 2 Oven interior light with removable cover.
15, Broil element.
16. Selffcleaning oven interior.
17. Convection bake cooking dual fan system.
18. Adjustable interior oven rack(s).
19. Large 3-piece oven door handle.
20. Full width oven door with window.
21. Warm & serve drawer.
22. 7" single radiant element.
23, Keep warm radiant element.
24, 5"/7" double radiant element.
25, Bridge radiant element.
26, 7" single radiant element.
27, 9" single radiant element.
28, Ceramic glass cooktop.
The features shown for your appliance may vary
according to model type & color.
background
About the ceramic glass cooktop
The ceramic cooktop has radiant surface elements
located below the surface of the glass. The design of the
ceramic cooktop outlines the area of the surface element
underneath. Be sure to match the pan size with the
diameter of the element outline on the cooktop and only
fiat-bottom cookware should be used.
The type and size of cookware, the number of surface
elements in use and their settings, are all factors that
will affect the amount of heat that will spread to areas
beyond the surface elements. The areas surrounding the
elements may become hot enough to cause burns.
About the radiant surface elements
The element temperature rises gradually and evenly.
As the temperature rises, the element will glow red. To
maintain the selected setting the element will cycle on and
off. The heating element retains enough heat to provide a
uniform and consistent heat during the off cycle.
For efficient cooking, turn off the element several minutes
before cooking is complete. This will allow residual heat
to complete the cooking process.
Element ON & hot surface indicator lights
Your appliance is equipped with two different types of
radiant surface control indicator lights that will glow on
the backguard- the Element On indicator light and the
hot surface indicator lights.
The element ON indicator lights are located on the
control panel (Figure 1) between the two radiant element
control knob and will glow when a surface element is
turned ON.
o OFF ©
• 0
to to
2
OFF
4
on rned
_element ON
indicator
light
Figure 1
Element OH indicator light location,
Model A only."
The hot surface indicator light located on the cooktop
(Figure 2) will glow when any surface cooking area heats
up and will remain on until the glass cooktop has cooled
to a MODERATE level.
/ \\
hot surface )
\ indicator
Figure 2 - Model A only
Hot surface indicator light location,
Radiant elements have a limiter that allows the element
to cycle ON and OFF, even at the HI setting. This
helps to prevent damage to the ceramic smooth top.
Cycling at the HI setting is normal and can occur if the
cookware is too small for the radiant element or if the
cookware bottom is not fiat.
Be sure to read detailed instructions for ceramic glass
cooktop cleaning in the General Care 8=Cleaning
section and Before You Call checklist section of this
Use and Care Guide,
background
The electronic surface element control
(ESEC) (Models B & C only)
The Electronic Surface Element Contro! (ESEC) feature
includes digital display windows. The ESECfeature
provides a numeric digital setting for the radiant surface
element positions on the cooktop. These settings work
the same way as normal knob setting indicators work
except the settings are displayed in digital windows.
The available ESEC display settings
The ESECcontrol provides various heat levels from Hi
(Figure 2) to Lo (Figure 5) and OFF (Figure 1). The
settings between 3.0 and 9.5 increase or decrease in
increments of .5 (1/2). The settings between 1.2 and
3.0 are Simmer settings which decrease or increase in
increments of .2 (1/5) to Lo (Figure 5; lowest Simmer
setting) for more precise settings at lower heat levels. Use
the Recommended Surface Setting Chart to determine the
correct setting for the kind of food you are preparing.
ESEC power failure indicator message (PF)
When the range is first plugged in or when the power
supply to the range has been interrupted, the ESEC
contro! will display the message "PF" (Power Failure;
Figure 6). After a few seconds the "PF" message will
disappear from the display.
ESEC hot element indicator message (HE)
After using any of the single or dual radiant element
positions the cooktop will become very hot. Even after
turning the control knob to OFF,the coo_op will remain
hot for some time. The ESECcontrol monitors the
temperature of the cooktop and displays the message
"HE" (hot element) warning when the cooktop is still too
hot to touch (Figure 4). If the HE message appears in the
window, the control can still be turned ON again for use.
ESEC error indicator message (Er)
An error message will be displayed (glowing "Er") at
power up (or after a power failure) if ANY of the surface
contro! knobs were left in the ON positions (Figure 7).
If a power failure should occur, be sure to set all of the
surface control knobs to the OFF position. This will reset
the surface controls.
Once the surface controls have been set to the OFF
positions, the surface controls should return to normal
operation. If the surface controls do not function and
the "Er" message remains in any display after following
these procedures, contact your authorized servicer for
assistance.
OFF OFF OFF
hi to hi Io hi |_
Figure 1[ Figure 2 Figure 3
hi OFF [o hi OFF to Figure 6
Figure 7
Figure 4
Control knobs shown are typical only,
Figure 5
Surface cooking settings
Use the chart to determine the correct setting for the
type of food you are preparing.
Note" The size and type of cookware used will influence
the setting needed for best cooking results.
HIGH (HI) Start most foods; bring water to a boil
and pan broiling.
MEDIUM HIGH Continue a rapid boil; frying, deep fat
(8-10) frying.
MEDIUM (6)...........Maintaina siow boiiithickensauces
and gravies; steaming vegetables.
MEDIUM LOW Keep foods cooking; poaching and
(2 -4) stewing.
LOW (LO) Keep warm, melting and simmering.
Radiant elements have a limiter that allows the element
to cycle on and off, even at the HI setting. This helps to
prevent damage to the ceramic smooth top. Cycling at
the HI setting is normal and can occur if the cookware
is too small for the radiant element or if the cookware
bottom is not flat.
background
Using proper cookware
The size and type of cookware used will influence the
setting needed for best cooking results. Be sure to follow
the recommendations for using proper cookware as
illustrated in Figures 1 & 2.
Cookware should have flat bottoms that make good
contact with the entire surface heating element (Figure
1). Check for flatness by rotating a ruler across the
bottom of the cookware (Figure 2).
*CORRECT iNCORRECT
t t
e Flat bottom and straight
sides.
• Tight fitting lids.
e Weight of handle does not
tilt pan. Pan is well
balanced,
o Pan sizes match the
amount of food to be
prepared and the size of
the surface element,
• Made of a material that
conducts heat well,
e Easy to clean.
® Always match pot diameter
to element surface
diameter.
e Curved and warped pan
bottoms.
o Pan overhangs element by
more than one-half inch.
o Pan is smaller than
element.
• Heavy handle tilts pan.
Figure 1
Cookware material types
The cookware material determines how evenly and quickly
heat is transferred from the surface element to the pan
bottom. The most popular materials available are:
Aluminum- Excellent heat conductor. Some types
of food will cause it to darken (Anodized aluminum
cookware resists staining & pitting). :If aluminum pans
slide across the ceramic glass cooktop, they may leave
metal marks which will resemble scratches. Remove
these marks immediately.
Copper- Excellent heat conductor but discolors easily. Nay
leave metal marks on ceramic glass (see Aluminum above).
Stainless steel- Slow heat conductor with uneven cooking
results. :Is durable, easy to clean and resists staining.
Cast iron- A poor heat conductor however will retain
heat very well. Cooks evenly once cooking temperature is
reached. Not recommended for use on ceramic cooktops.
Porcelain=enamel on metal- Heating characteristics
will vary depending on base material. Porcelain-enamel
coating must be smooth to avoid scratching ceramic
cooktops.
Glass= Slow heat conductor. Not recommended for
ceramic cooktop surfaces because it may scratch the
glass.
Due to the high intensity of heat generated by the
surface elements, the glass surface will turn green
when the element will be turned off. This phenomenon
is normal and the glass will come back to its original
white color after it has completely cooled down. (White
Figure 2
background
Single radiant surface elements (all models)
The cooktop has 2 or 3 SINGLE radiant surface elements:
the left rear position (Figures 1, 2 & 3), the right rear
position (Figures 1 and 2), and the right front position
(Figures 1 and 3). The left rear element may also be used
with the Bridge element (Model C only - Figure 3).
To Operate the Single Radiant Surface Elements
1, Place correctly sized cookware on the radiant surface
element.
2. Push in and turn the surface control knob in either
direction to the desired setting (Figure 4). Start most
cooking operations on a higher setting and then turn
to a lower setting to finish cooking. Each surface
element provides a constant amount of heat at each
setting. A glowing red surface heating area extending
beyond the bottom edge of the cookware indicates
the cookware is too small for the surface heating
area.
3. When cooking has completed, turn the surface
control knob to OFF before removing the cookware.
Figure 1 - Model A
The surface "Element On" indicator lights will glow
when one or more elements are turned on. A quick
glance at these indicator lights when cooking is finished
is an easy check to be sure all surface elements are
turned off.
Figure 2 - Model B
Figure 3 - Model C
OFF
See Recommended Setting for Surface Element table on
3
8
Do not place plastic items such as salt and
pepper shakers, spoon holders or plastic
wrappings on cooktop when it is in use, These
items could melt or ignite. Potholders, towels or
wooden spoons could catch fire if placed too close to
Do not allow aluminum foil, or ANY material that
can melt to make contact with the ceramic glass
cooktop, If these items melt on the cooktop they will
damage the ceramic €ooktop:..........................................................................................................................................................................
4 6
reed
Figure 4 - Control knob shown istypical only.
Radiant surface elements may appear to have cooled
after they have been turned OFF. HE (Hot Element)
message (Models B & C) or the hot surface indicator
light (Model A) will turn ON and will continue to glow
until the glass cooktop has cooled down to a moderate
level. The glass surface may still be hot and burns
may occur if the glass surface is touched before the
indicator light has turned OFF. The message may
.......... 0 h°ugh the c0nt nedO FF................................................
background
Dual Surface Radiant Element (all models)
The cooktop is equipped with 1 or 2 dual radiant surface
elements located at the left front (Figures l& 2) and
the right front (Figure 2) or the right rear (Figure 3)
position. Symbols around the knob are used to indicate
which coil of the dual radiant element will heat. The o
symbol indicates that only the inner coil will heat (Figure
4). The ® symbol indicates that both inner and outer
coils will heat (Figure 5). You may switch from either coil
setting at any time during cooking.
To Operate the Dual Surface Element
1. Place correcUy sized cookware on the dual surface
element.
2. Push in and turn the control knob to the inner coil
symbol for smaller cookware (Figure 4) or to inner
and outer coil symbol for larger cookware (Figure 5).
Turn the knob to adjust the setting if needed. Start
most cooking operations on a higher setting and then
turn to a lower setting to finish cooking. Each surface
element provides a constant amount of heat at each
setting. A glowing red surface heating area extending
beyond the bottom edge of the cookware indicates the
cookware is too small for the surface heating area.
3. When cooking has completed, turn the surface
control knob to OFF before removing the
cookware,
Figure 1 - Model A Figure 2 - Model B
Figure 3 - Model C
The surface "Element On" indicator lights will glow
when one or more elements are turned on. A quick
glance at these indicator lights when cooking is finished
is an easy check to be sure all surface elements are
turned off.
J J
Figure 4 Figure 5
Do not place plastic items such as salt and pepper
shakers, spoon holders or plastic wrappings on
cooktop when it is in use. These items could melt or
ignite. Potholders, towels or wooden spoons could catch
Do not allow aluminum foil, or ANY material that
can melt to make contact with the ceramic glass
cooktop, If these items melt on the cooktop they will
damage the ceramic cooktop.
See Recommended Setting for Surface Element table on
Radiant surface elements may appear to have cooled
after they have been turned OFF. lie (Hot Element)
message (Models B & C) or the hot surface indicator
light (Model A) will turn ON and will continue to glow
until the glass cooktop has cooled down to a moderate
level. The glass surface may still be hot and burns
may occur if the glass surface is touched before the
indicator light has turned OFF.The message may remain
o e hough Lhe¢°ntrol dO FF...........................................................
background
Bridge surface radiant element (Model¢ only)
The cooktopisequippedwitha "BRIDGE" surfaceelement
locatedat theleftFrontand middle(Fig.i) positions.
The Bridgecan be used when cookingwith rectangular
(likea griddle)or ovalshaped cookware.The element
willmaintainan even temperaturesettingacrossboth
portionsofthe Bridge.Ifneeded fornormalcookware,
theBridgeelementcan work likea singleelementwithout
theBridge(Fig.4).The ® symbol indicatesthatonlythe
Frontpotionwillheat(Fig.2).The _ symbol indicatesthat
bothFrontand middleportionswillheat(Fig.3).You may
switchfrom eithercoilsettingat any timeduringcooking.
To Operate the Bridge Surface Element
1. Place correctly sized cookware on the Bridge surface
element.
2. Push in and turn the control knob as shown in Figure
2 to heat the front portion of the Bridge element for
normal shaped cookware or in Figure 3 for larger
or rectangular shaped cookware. Turn the knob to
adjust the setting if needed. Start most cooking
operations on a higher setting and then turn to a
lower setting to finish cooking. Each surface element
provides a constant amount of heat at each setting.
A glowing red surface heating area extending
beyond the bottom edge of the cookware indicates
the cookware is too small. Please note that not all
cookware will fit the Bridge element correctly.
3. When cooking has completed, turn the surface
control knob to OFF before removing the cookware.
The BRIDGE element may also be used in combination
with the left rear single element (Fig. 6). Because these
elements have 2 different controls, one element can be
used to cook while the other element may be used to
keep food warm.
U
Figure :[
OFF o _ OFF
hi hi hi hi
0
Do not place plastic items such as salt and pepper
shakers, spoon holders or plastic wrappings on
cooktop when it is in use. These items could melt or
ignite. Potholders, towels or wooden spoons could catch
fire if placed too close to the surface elements.
Do not allow aluminum foil, or ANY material that
can melt to make contact with the ceramic glass
cooktop, If these items melt on the cooktop they will
damage the ceramic cooktop.
The surface"Element On" indicatorlights will glow when
one or more elements are turned on. A quick glance at
these indicator lights when cooking is finished is an easy
check to be sure all surface elements are turned off.
Figure 4 Figure 5
Front portion Front & Middle
only portions
Figure 6
Front & Middle
plus Left Rear
Radiant surface elements may appear to have cooled
after they have been turned OFF. lie (Hot Element)
message will turn ON and will continue to glow until the
glass cooktop has cooled down to a moderate level. The
glass surface may still be hot and burns may occur if
the glass surface is touched before the indicator light has
turned OFF. The message may remain on even though
the controls are turned OFF.
background
Keep warm zone (ModelsB& Conly)
Thepurposeofthe keepwarmzoneisto keephot
cookedfoodsat servingtemperature.Usethekeepwarm
featureto keepcookedfoodshotsuchas:vegetables,
gravies,casseroles,soups,stews,breads,pastriesand
oven-safedinnerplates.
Alwaysstartwithhotfood.It isnotrecommendedto
heatcoldfoodonthekeepwarmzone.Allfoodplaced
onthekeepwarmzoneshouldbecoveredwitha lidto
maintainquality.
Forbestresults,whenwarmingpastriesor breads,
thecovershouldhaveanopeningto allowmoisture
to escape.Do not use plastic wrap to cover food.
Plastic may melt onto the surface and be very
difficult to clean. Use only plates, utensils and
cookware recommended for oven and cooktop use on the
keep warm zone.
To Set the keep warm zone control
NOTE: The controls and indicator light are located on the
contro! panel.
1. Touch the oneoff pad (Fig. 4) at the keep warm zone
controlposition. The keep warm indicator light will flash.
Note: If no further pads are touched within 25 seconds
the request to power the keep warm zone ON will clear.
2. At the keep warmer zone controls position touch ^
once to turn ON the power level for HI (Fig. 1) or v to
turn ON the power level for LO (Fig. 3).
3. Each touch ^ or v will increase or decrease the
power levels. The keep warm zone has 5 power levels
from HI (Fig. 1) through NED (Fig. 2) to LO (Fig. 3).
The power level may be adjusted at any time while
the keep warm zone is ON.
4. When it is time to serve the food, touch the oneoff
pad once to turn the keep warm zone OFF. The keep
warm zone indicator light will turn OFF.
keep warm
zone
hi hi m A
E
m _ hi _ hi
[] ] :1
[] med [] med _ med med m
[] low [] low [] low low m
Figure 1 Figure 2 Figure 3
V
The keep warm zone will not glow red when it is hot,
but becomes hot enough to cause burns. Avoid placing
hands on or near the keep warm zone until the keep
warm zone hot surface indicator light is OFE Always
use potholders or oven mitts when removing food from
the keep warm zone as cookware and plates will be
hot,
Do not place plastic items such as salt and pepper
shakers, spoon holders or plastic wrappings on
cooktop when it is in use. These items could melt or
ignite. Potholders, towels or wooden spoons could catch
fire if placed too close to the surface elements.
Do not allow aluminum foil, or ANY material that
can melt to make contact with the ceramic glass
cooktop. If these items melt on the cooktop they will
damage the ceramic cooktop.
Keep warm zone temperature selection
Refer to the keep warm zone table for recommended
heating levels. If a particular food is not listed, start with
the medium level, and adjust as needed. Most foods can
be kept at serving temperatures by using the medium
level.
Food Item Se_ing
Bacon ..................................................................................................,i................................
Hamburger Patties HI
Poultry, Pork Chops HI
Vegetables, Eggs NED
Roasts (Beef, Pork, Lamb) NED
Biscuits, Pastries MED
Rolls,..........................................................................................................................................................................................hard NED
Rolls (soft) LO
Empty Dinner Plates LO
W
on.off m
Figure 4
background
Oven vent location
The oven is vented at the center rear of the cooktop.
When the oven is on, warm air is released through the
vent. This venting is necessary for proper air circulation
in the oven and good baking results. DO NOT BLOCK
OVEN VENT. Never close off the openings with
aluminium foil or any other material.
(Hodel C shown only)
Arranging oven racks
ALWAYS ARRANGE OVEN RACKSWHEN THE OVEN IS
COOL (PRIOR TO OPERATING THE OVEN). Always use
oven mitts when using the oven.
To remove an even rack, pull the rack forward until it
stops. Lift up front of rack and slide out.
To replace an oven rack, fit the rack onto the guides
on the oven walls. Tilt the front of the rack upward and
slide the rack back into place.
(Hodels A & B shown only)
Recommended rack positions
Some models are equipped with a blower
which runs in baking and self=denning mode
to keep all internal components at a cool
temperature. The blower may keep running
even if the oven has been turned off, until the
components have cooled down.
Air circulation in the oven
If using 1 rack, place in center of oven. If using multiple
racks, stagger cookware as shown.
For best air circulation and baking results allow 2-4"
(5-10 cm) around the cookware for proper air circulation
and be sure pans and cookware do not touch each other,
the oven door, sides or back of the oven cavity. The hot
air must circulate around the pans and cookware in the
oven for even heat to reach around the food.
Broiling meats, chickenor fish 4 4
Cookies, cakes, pies, biscuits & muffins
Using a single rack 2 or 3 2 or 3
Using two racks 2 and 4
Using multiple racks
(If equippedwith an offset rack)
Frozenpies,angelfood cake,
yeast,bread, 1 or 2 casseroles, 1 or 2 1 or 2
smallcuts of meator poultry
Turkey, roast or ham 1 1
2 and 4
2, 3 and 4
1, 3 (offset) 4
2, 3 and 4
Single Oven Rack
Rack
positions
(Models A & B shown only)
Multiple Oven Racks Always use caution when removing food from the oven.
background
Types of oven racks
Your built-in range may be equipped with one or more of
the oven racks styles shown;
• Flat handle oven rack (All models - Figure 1).
• Offset oven rack (Model A only - Figure 2).
• Flat oven half rack (Models B & C only - Figures 3 & 4).
• Effortless T. oven rack (Models B & C only - Figure 5).
Figure 1 = All models Figure 2 = Hodel A only
Flat handle oven rack Offset oven rack
Figure 3 = Models B 8=¢ only
Flat half oven rack - Closed position
Always use pot holders or oven mitts when adjusting the
oven racks. Wait until the oven has completely cooled if
os ble:Ovenrac maybeHO an ayc auseburns: ........
The Fiat Oven Handle Rack has an handle to facilitate
the sliding of the rack when large amount of foods weight
on it.
The Flat Oven Half Rack has a removable insert that
can provide extra space for larger food items. The right
half rack portion may still be used for other food items
like a casserole dish (See Figure 3 & 4). To remove the
insert, squeeze on the left front insert side (See Figure
6) of the rack and tilt out clockwise. To reinstall, insert
rear hooks at back of insert (See figure 6) and lay insert
down. Make sure both insert front hooks snap into rack
(See figure 7).
The Offset Oven Rack is used to maximize cooking
space (See Figure 2). The offset rack can be used in
the lower rack position to roast large cuts of meat and
poultry.
Do not use cookware that extends beyond the edge
of the Flat Half Rack. For best results, allow 2 inches
between the pan placed on the rack and oven side or
rear walls.
Figure 4 = Models B 8=C only
Flat half oven rack - Open position
Figure 5 - Hodels B & C only
Effortless T" oven rack
Figure 6
Figure 7
background
The Effortless TM oven rack system
Some models are equipped with a special oven rack
system that automatically partially extends the oven rack
from the interior oven glides to assist in easier access to
your food items, This feature works whenever the oven
door is opened or closed,
To assemble the Effortless TM Oven Rack system:
1. Locate all required parts, You will need the supplied
oven rack (Effortless TM Oven Rack is a fiat rack with a
special dark coating on the left and right rack sides)
and the 2 supplied chrome connector arms,
2. Open the oven door, Be sure the oven is completely
coo! before proceeding,
3. Place the oven rack in positions 1, 2 or 3 only (see
previous page to verify positions), Be sure the rack
connector brackets are at the rear of the range and
pointing towards oven bottom (See Figure 2),
4. Assemble one connector arm at a time, With the oven
door open and the oven rack in place, install one end
of the connector arm to the hole in the door connec-
tor bracket (Figure 1) and the other end in the hole
in the rack connector bracket (Figure 2 and as in
Figure 3), The oven rack may need to be adjusted in
or out in the rack position to match the length of the
connector arm.
5. While holding the connector arm in place, twist the
connector arm so the ends of the connector arm
point upwards (See Figures 4 & 5). The connector
arm should now be locked into position,
6. Repeat steps 4 and 5 for the other connector arm,
7. Once both connector arms are properly in place, be
sure to test the oven rack operation by gently closing
the oven door, The oven rack should move in and out
of the oven freely when the door is opened or closed.
REMOVE ALL OVEN RACKS and parts before
starting a self-clean cycle, If the oven racks are left
in the oven during the self-clean cycle, the glide ability
of the Effortless Oven Rack system will be damaged
and will cause all oven racks to loose their shiny
finish and or turn blue. Remove ALL oven racks and
clean according to instructions provided in the Care &
Cleaning section of this manual.
Make sure the oven and oven racks are COMPLETELY
cooled and safe to touch before attempting to assemble
or disassemble the Effortless TM Oven Rack system.
Never ............................................................................................................
Door Rack
connector onnector
bracket bracket
o
Connectorarm Oven rack
Open oven door
"Connector arm
Figure 3 - Assembly of the EffortlessT"oven rack
Connector
door connector-
brackets with
connector arm
shown in locked positior
(pointing upwards)
Figure 6 - EffortlessTM oven rack after assembly
background
Control pad features
READ THE INSTRUCTIONS CAREFULLY BEFORE USING THE OVEN, For satisfactory use of your oven, become
familiar with the various features and functions of the oven as described below. Detailed instructions for each
feature and function follow later in this Use & Care Guide.
Figure 1 - Model A & B
1. Delay start pad--Use to program a Delayed Timed
Bake or Delay Self-Cleaning cycle start time.
2. Bake time pad--Use to enter the length of the
baking time.
3. Set clock pad--Use to set the time of day.
4. Timer on=off pad--Use to set or cancel the Timer.
The Timer does not start or stop cooking.
5. My favorite pad (some models)--Use to record a
temperature setting for a cooking feature.
6. Oven light pad--Use to turn the oven light ON and
OFF.
7. Oven lockout pad--Use to lock the oven door and
the control panel pads.
8. Bake pad--Use to select the bake cooking feature.
9. Broil pad--Use to select the broil cooking feature.
10. Convection pad--Use to select between the
Convection Bake, Convection Roast and Convection
Broil (model B & C only) cooking features.
11, Quick preheat or power plus preheat pad=Use
to quickly raise oven to cooking temperature.
IMPORTANT THINGS TO KNOW BEFORE
SETTING ANY OVEN COOKING FEATURE
This appliance has been factory pre-set to start any
BAKE, CONVECTION BAKE, CONVECTION ROAST
or PREHEAT feature with the oven set temperature
automatically set for 35001:. The BROIL or CONVECTION
BROIL features are pre-set at 55001:. However if desired, the
oven set temperature may be adjusted at any time during
the cooking process. You may also choose to add a BAKE
TIME or DELAY START with most of the functions listed
above, unless specified in their corresponding section.
Figure 2 - Model C
12. Keep warm pad--Use to keep the dishes and food
warm until served.
13. Pizza pad (some models)--Use to select the pizza
cooking feature.
14. Chicken nuggets pad--Use to select the chicken
nuggets cooking feature.
IS, Self-Clean pad--Use to select the self cleaning
feature.
16. Convection convert pad--Use to convert a regular
recipe temperature to a convection temperature.
17, Add a minute pad (some models)=Use to add a
minute to the timer feature.
18. Numeric pad=Use to enter temperatures and
times.
19. Start pad--Use to start all oven features (not used
with Oven Light).
20. Cancel pad=Use to cancel any oven feature
previously entered except the time of day and minute
timer.
TEM PERATU RE VISUAL DISPLAY
Your oven is equipped with a temperature visual display.
When a cooking mode is set, the actual temperature will
be shown in the display and will rise as the unit preheat.
When the unit has reached its target temperature, a chime
will sound to remind you to place the food in the oven.
This feature will be active with some cooking modes;
BAKE, CONVECTION BAKE, CONVECTION ROAST
and PIZZA.
The lowest temperature that can be displayed is 100°F.
background
MINIMUM AND MAXIMUM CONTROL PAD SETTINGS
All of the features listed below have minimum and maximum time or temperature settings that may be entered into the
control. An ENTRY acceptance beep will sound each time a control pad is touched (the acceptance beep on the Oven
Lockout pad is delayed 3 seconds).
An ENTRY ERRORtone (3 short beeps) will sound if the entry of the temperature or time is below the minimum or above
the maximum settings for the feature.
BAKE 170°F/77°C 550°F/288°C
BROIL 400°F,1205°C 5500F,1288°C
CONVECTION BAKE 170°F/77°C 550°F/288°C
CONVECTION ROAST 1700F/77°C 550°F/288°C
CONVECTION BROIL 400°F/205°C 550°F/288°C
PIZZA 170°F/77°C 5500F/288°C
CHICKEN NUGGETS 170°F/77°C 550°F/288°C
TIMER 12Hr. Mode 0:01 Minl 11:59 Hr./Minl
24 Hr. Mode 0:01 Min. 11:59 Hr./Min.
CLOCK T!ME 12HF, MOde 1:00 Hr,/Min, 12:59 Hr,/Min:
24 Hr. Mode 0:00 Hr./Min. 23:59 Hr./Min.
i
DELAY START 12HF. Mode 1:00 Hr./Min: 12:59 Hr./Min:
24 Hr. Mode 0:00 Hr./Min. 23:59 Hr./Min.
BAKE TIME 12 Hr. Mode 0:01 Min: 5:59 Hr./Min:
24 Hr. Mode 0:01 Min. 5:59 Hr./Min.
i
SETTING THE CLOCK
The SET CLOCK pad isused tosettheclock.The clockmay
be setfor12 or 24 hour time of day operation.The clock
has been presetat the factoryforthe 12 hour operation.
When the range isfirstplugged in,or when the power
supplyto the rangehas been interrupted,thetimerinthe
display will flash.
To set the clock (example below for 1:30)
1. Press SET CLOCK. "CLO" will appear in the display.
2. Press 1 3 0 pads to set the time of day to 1:30. "CLO"
will stay in the display.
3. Press START. "CLO" will disappear and the clock will
start.
CHANGING BETWEEN 12 OR 24 HOURTIME
OF DAY DISPLAY
1. Pressand holdSET CLOCK for6 seconds."CLO" will
appear inthedisplay.
2. CONTINUEholdingthe pad until"12HrdAY"or"24Hr
dAY" appears in the display and the control beeps
once.
3. Press SELF CLEAN to switch between the 12 and 24
hour time of day display. The display will show either
"12Hr dAY" or "24Hr dAY".
4. PressSTART toacceptthe changeor pressCANCEL to
rejectthechange.
5. Resetthe correcttimeas describedinTo setthe Clock
above.Pleasenotethatifthe24 hourtimeofday mode
was chosen, the clock will now display time from 0:00
through 23:59 hours.
background
SETTING CONTINUOUS BAKE OR 6 HOUR
ENERGY SAVING
The TIMER and SELF CLEAN pads control the Continuous
Bake or 6 Hour Energy Saving features. The oven control has
a factory preset built-in 6 Hour Energy Saving feature that
will shut off the oven if the oven control is left on for more
than 6 hours. The oven can be programmed to override this
feature for Continuous Baking.
To set the control for Continuous Bake or 6 Hour
Energy Saving features
1. Press and hold TIMER for 6 seconds.
After 6 seconds "6Hr OFF" or "STAY On" will appear
in the display and the control will beep once.
2. PressSELF CLEAN to switch between the 6 Hour Energy
Saving and continuous bake features.
Note: "6Hr OFF" in the display indicatesthe control isset for
the 6 Hour Energy Saving mode and"SLAY On" indicates
the control is set for the Continuous Bake feature.
3. PressSTARTLo accept the change (display will return to
time of day) or press CANCEL to reject the change.
SETTING TEMPERATURE DISPLAY m
FAHRENHEIT OR CELSIUS:
The BROIL and SELF CLEAN pads control the Fahrenheit
or Celsius temperature display modes. The oven control can
be programmed to display temperatures in Fahrenheit or
Celsius. The oven has been preset at the factory to display
in Fahrenheit.
To change display from Fahrenheit to Celsius or
Celsius to Fahrenheit
1. To tell if the display isset for Fahrenheit or Celsius press
BROIL and hold it for 6 seconds; "550 °,, will appear
and "BROIL" will flash in the display and a beep will
sound. If"FAhrnht" appears, the display is set to show
temperatures in Fahrenheit. If"CELSIUS" appears, the
display is set to show temperatures in Celsius.
2. Press SELF CLEAN to switch between Fahrenheit or
Celsius display modes. The display will show either
"FAhrnht" or "CELSIUS"
3. Press START to accept the change or press CANCEL
to reject the change.
SETTING SILENT CONTROL OPERATION
The DELAY START and SELF CLEAN pads control the
Silent Control operation feature. The Silent Control operation
feature allows the oven control to be operated without
sounds or beeps whenever necessary. If desired the control
can be programmed for silent operation and later returned
to operating with all the normal sounds and beeps.
To change control from normal sound operation to
silent control operation
1. To tell if your range is set for normal or silent operation
press and hold DELAY START." .... "will appear and
"DELAY" will flash in the display. After 6 seconds"bEEP
On" or "bEEP OFF" will appear in the display.
2. Press SELF CLEAN to switch between normal sound
operation and silent operation mode. The display will
show either "bEEP On" or "bEEP OFF".
Note: If"bEEP On" appears, the control will operate with
normal sounds and beeps. If"bEEP OFF" appears,
the control is in the silent operation mode.
3. Press START to accept the change or press CANCEL
to reject the change.
Note" The control will always beep at the end of a minute
timer and will beep when a set temperature has been reached,
even if the control is set to silent operation.
background
SETTING MINUTE TIMER
The TIMER ON'OFF padcontrolstheMinuteTimerfeature.
The Minute Timer serves as an extra timer in the kitchen
that will beep when the set time has run out, It does not
start or stop cooking, The Minute Timer feature can be
used during any of the other oven control functions, Refer
to "Minimum and Maximum Contro! Pad Settings" for time
amount settings,
To set the Minute Timer (example for 5 minutes)
1. PressTIMER ON,OFF," ...."willappearand"Timer"
willflashinthe display.
2. Pressthe number pads to setthe desiredtime inthe
display.
3. PressSTART. The timewillbeginto countdown with
"5:00" and "Timer" willstayinthedisplay.
Note: IfSTART isnotpressedthetimerwillreturnto the
timeof day after25 seconds.
4. When the settime hasFun out,"End" and "Timer" will
show inthe display.The clockwillsound with3 beeps
every5 secondsuntilTIMER ON,OFF ispressed.
To cancel the Minute Timer before the set time has
run out
1. PressTIMER ON,OFF. The displaywillreturntothetime
of day.
SETTING OVEN LOCKOUT FEATURE
The _ pad controls the Oven Lockout feature. The Oven
Lockout feature automatically locks the oven door and
prevents the oven from being turned on. It does not disable
the clock, Minute Timer or the interior oven lights.
To activate the Oven Lockout feature
1. Press and hold _ for 3 seconds.
2. After 3 seconds"door Loc"will appear, a beep will sound
and "DOOR" and I_1will flash in the display. Once the
oven door is locked the "DOOR" and I_1indicators will
stop flashing and remain on along with the "Loc"
To reactivate normal oven operation:
1. Press and hold _ for 3 seconds. After 3 seconds"door
OPn" will appear and a beep will sound. The "DOOR"
and i_ will flash in the display until the oven door has
completely unlocked
2. The oven is again fully operationa!.
SETTING ADD :1. MINUTE FEATURE (some
models)
The ADD :[ MINUTE pad is used to set the Add 1 Minute
feature. When the ADD :[ MINUTE pad is pressed, 1
minute is added to the Minute Timer feature if this feature
is already active. If the Minute Timer feature is not active
and the ADD :[ MINUTE pad is pressed, the Minute Timer
feature will become active and will begin counting down
from 1 minute.
background
SETTING QUICK OR POWERPLUS TM PREHEAT
The PREHEAT pad controls the Quick or PowerPlusTM
Preheat feature. The Preheat feature will bring the oven
up to temperature and then indicate when to place the
food in the oven. Use this feature when recipes call for
preheating. Preheating is not necessary when roasting or
cooking casseroles. The oven can be programmed to preheat
at any temperature between 170°F to 550°F.
To set the Preheat temperature for 375°F
1. Arrange the interior oven racks.
2. Press PREHEAT. "350" will appear in the display. If a
preheat of 350°F is needed, press START.
3. Press 3 7 5.
4. Press START. "PRE" will be displayed while the oven is
preheating.
5. PressCANCEL when baking is complete or to cancel
the preheat feature.
After the oven has reached the desired temperature (this
example, 375°F) the control will beep and the "PRE" light
will turn off, the BAKEfeature will activate and oven target
temperature will be displayed. If you missed hearing the
beep, you can tell that the oven has reached preheat
temperature if you see the oven temperature showing in
the oven display. Once the oven has preheated, place
food in the oven. ,The preheat temperature can only be
changed while the PRE message is displayed.
To change Preheat temperature while oven is
preheating (ex: changing from 375°F to 425°F)
If it is necessary to change the preheat temperature while
the oven is preheating to the original temperature:
1. While preheating, press PREHEAT. "375" will appear
in the display.
2. Enter the new preheat temperature. Press 4 2 5.
3. Press START. "PRE" will be shown in the display.
Note: A beep will sound once the oven temperature reaches
425°F and the display will show "425 °'.
4. When baking is complete press CANCEL.
SETTING BAKE
The BAKE pad controls normal baking. Ira rapid preheating
is preferred, refer to the POWERPLUS TM PREHEAT feature
for instructions. The oven can be programmed to bake at
any temperature from 170°F to 55001:.
Baking Tips:
- Preheat your oven before using the bake mode.
• During preheat, the 3 elements and the convection fan
are used in cycle to quickly heat the oven.
• Use only one rack and center the pans as much as pos-
sible on rack 2 or 3.
• If using two racks, place the oven racks in positions 2
and 4.
• Allow 2" to 4" (5,1 to 10,2cm) around the utensil(s) for
proper air circulation.
• Be sure the pans do not touch each other, the door,
sides or back of the oven.
To set the Bake Temperature to 375°F
1. Arrange interior oven racks.
2. Press BAKE, "350"will appear in the display. Ira bake
of 350°F is needed, press START.
3. Press 3 7 5.
4. PressSTART. The actual temperature will be displayed.
A beep will sound once the oven temperature reaches
375°F and the display will show "375 °':
5. Place food in the oven.
Pressing CANCEL will stop the feature at any time.
To change the Bake Temperature
(example" changing from 375°F to 425°F)
1. After the oven has already been set to bake at 375°F
and the oven temperature needs to be changed to 425°F,
press BAKE and "375" will appear in the display.
2. Press 4 2 5.
3. Press START.
While in preheat mode, the convection fan will be activated
during the first rise of temperature to allow the oven to
reach its target temperature faster. The Bake, Broil and
Convection elements will also cycle for a better heat
distribution.
During the first rise of temperature, the convection fan
will be activated to allow the oven to reach its target
temperature faster. The Bake, Broil and Convection
elements will also cycle for a better heat distribution.
background
SETTING CONVECTION BAKE
Thismode ofcookingenablesyou toobtainthebestculinary
resultswhen bakingwithmultiplepans and racks.Multiple
rackbakingmay slightlyincreasecooktimeforsome foods
but the overallresultistime saved.Some food may cook
Fasterand more evenlywithConvectionBake.Convection
baking uses the three elements and a fan to circulate
the oven'sheat evenlyand continuously withinthe oven.
The oven can be programmed for Convectionbaking at
any temperaturebetween 170°F to 550°F with a default
temperatureof 350°F.
Convection Baking Tips:
e Always preheat your oven before using the Convection
Bake mode.
e During preheat, the 3 elements and the convection fan
are used in cycle to quickly heat the oven.
e If your recipe cooking temperature has already been
converted for convection baking there is no need to re-
duce your oven temperature. If your recipe has not had
the temperature converted for convection baking you
can easily reduce using the Convection Convert feature.
Please see Convection Convert section on next page for
further instruction on temperature conversion.
• Use tested recipes with times adjusted for convection
baking when using this mode. Time reductions will
vary depending on the amount and type of food to be
cooked.
• When usingConvectionBakewitha singlerack,placeoven
rackinposition2 or 3.Ifcookingon multipleracks,place
theoven racksinpositions2 and 4; 1,3 (offsetrack)and
4 or 2, 3 and 4 ifthereisno offsetracksupplied
• Most bakeries(exceptcakes)shouldbe baked on pans
with no sides or very low sides to allow heated air to
circulate around the food.
• Food baked on pans with a dark finish will cook faster.
@
Oven Rack Positions
Figure 2
To set the oven for Convection Bake and temperature
to 375°F
1. Arrange interior oven racks.
2. Press CONVECT. "CONVECT" and "BAKE" will flash
and "350" will appear in the display. If a Convection
Bake of 350°F is needed, press START.
3. Press3 7 & "CONVECT'and"BAKE" will keep flashing
and "375 °" will appear in the display.
4. Press START. The actual oven temperature and the fan
icon will be displayed. A beep will sound once the oven
temperature reaches 375°F and the display will show
" ° ........ BAKE"
375 , CONVECT, and the fan icon.
5. Place food in the oven.
Pressing CANCEL will stop the feature at any time.
Benefitsof Convection Bake:
-- Multiplerackbaking.
-- Some foodscook faster,saving timeand energy.
-- No specialpans or bakeware needed.
Air circulation during Convection Bake
(Hodels A & B shown only)
Figure i
The convection fan will start AS SOON AS the oven is
set for Convection Bake. The display will show an icon
of rotating fan within a square. This rotating fan icon
indicates when the Convection Fan is operating. The Bake,
Broil and Convection elements will also cycle for a better
heat distribution.
background
SETTING CONVECTION CONVERT
The Convection Convert pad is used to automatically convert
a standard baking recipe for convection baking. When
set properly, this feature is designed to display the actual
converted (reduced) temperature in the display. Convection
Convert may ONLY be used with a Convection Bake cooking
mode. It can be used with the features Delay Start and
Bake Time (see their sections for directions). If convection
conversion is used with the Bake Time and Delay Start
features, "CF" (check food) will be displayed when 75% of
the bake Lime complete. At this Lime the oven contro! will
sound 3 long beeps at regular intervals until baking had
finished. When the bake Lime has completely finished the
control will display "End" and beep at regular interval until
the CANCEL pad is pressed.
To use this feature with the BAKE TIHE option, the BAKE
TIHE pad must be pressed before the CONVECTION
CONVERT pad.
To set the oven for Convection Bake with a standard
baking recipe temperature of 400°F:
1. Arrange interior oven racks.
2. Press CONVECT. "CONVECT" and "BAKE" will flash
and "350" will appear in the display.
3. Press400."CONVECT"and"BAKE"willkeepflashing
and "400 °" will appear in the display.
4. Press CONVECTION CONVERT. As soon as the
convectionconvertpad ispressed,the oven willstart
healing.The temperaturedisplayedwillbe 25°F lower
than what it used to be. The actual oven temperature
and the fan icon will be displayed. A beep will sound
once the oven temperature reaches 375°F and the
375 , "CONVECT'; "BAKE" anddisplay will show " o,,
the fan icon.
5. Place food in the oven.
When using a Bake Time under 20 minutes, the Convection
Convert will not beep and display the "CF" message.
SETTING CONVECTION ROAST
This mode is best for cooking tender cuts of beef, lamb, park
and poultry. Use this mode when cooking speed is desired.
The Convection Roasting gently browns the exterior and
seals in the juices. Convection roasting uses the hidden
bake element, the hidden convection element, the broil
element and a fan to circulate the oven's heat evenly and
continuously within the oven. The oven can be programmed
for Convection Roasting at any temperature between 170°F
to 550°F with a default temperature of 350°E
Convection Roasting Tips:
- Use a broiler pan and grid, and a roasting rack (available
by mail order). The broiler pan will catch grease spills
and the grid will help prevent spatters. The roasting rack
will hold the meat.
• Placean oven rackon rack position 1 (offset rack, if available).
• No preheat is needed in convection roast.
• Make sure the roasting rack is securely seated on the
grid in the broiler pan. The roasting rack fits on the grid
allowing the heated air to circulate under the food for even
cooking and helps to increase browning on the underside
(available by mail order only).
- There is no need to reduce the convection temperature or
to use the Convection Convert feature with this cooking
mode.
DO NOT use the broiler pan without the grid or cover
the grid with aluminum foil (available by mail order).
Always pull the rack out to the stop position before
removing food.
Position food (fat side up) on the roasting rack.
To set a Convection Roast Temperature of 375°F:
1. Arrange oven racks and place food in the oven.
2. Press CONVECT; "350" will be displayed; "CONVECT"
and "BAKE" will flash.
3. Press CONVECT again; "350" will be displayed;
"CONVECT" and "ROAST" will flash.
4. Enterthe desired roasting temperature using the number
pads 3 7 5.
5. Press START; The actual oven temperature will be
displayed, "CONVECT", "ROAST" and the fan icon will
be displayed. The Bake, Broil and Convection elements
will also cycle for a better heat distribution.
PressingCANCEL will stop the fea_re at any time...................................................
The Bake, Broil and Convection elements will cycle for a
better heat distribution.
background
SETTING CONVECTION BROIL (some
models)
Use thismode forthickercutsof meat,fishand poultry.
The Convection Broiling gently browns the exterior and
seals in the juices. Convection broiling uses the broil
element and a fan to circulate the oven's heat evenly and
continuously within the oven. The oven can be programmed
for Convection Broiling at any temperature between 300°F
to 550°F with a default temperature of 550°E
Convection Broiling Tips:
- For optimum browning, preheat the broil element for 5
minutes.
- Broil one side until the food is browned; turn and cook
on the second side. Season and serve.
- Always pull the rack out to the "stop" position before
turning or removing food.
-Always use a broiler pan and its grid when broiling
(available by mail order). It allows the dripping grease to
be kept away from the high heat of the broil element.
- DO NOT use the broil pan without the insert (available
by mail order). DO NOT cover the broil pan insert
with foil. The exposed grease could catch fire.
- If using a Searing Grill (available by mail order), preheat
the grill for 5 to 10 minutes before placing your meat.
- Convection broiling is generally faster than conventional
broiling. Check for doneness at the minimum
recommended time.
To set a Convection BroilTemperature of 500°F:
i. Arrangeoven racks.
2. PressCONVECT; "350"will be displayed; "CONVECT"
and "BAKE" will flash.
3. Press CONVECT again; "350" will be displayed;
"CONVECT" and "ROAST" will flash.
4. Press CONVECT again; "550" will be displayed;
"CONVECT" and "BROIL" will flash.
5. Enter the desired roasting temperature using the number
pads 5 0 0.
6. Press START; "550", "CONVECT", "BROIL" and the
fan icon will be displayed.
7. After 5 minutes of preheat, place food in the oven.
PressingCANCEL willstopthefeatureatanY time.
Accessories available via the enclosed brochure:
Figure 1 Figure 2
Broiler Pan
& Insert
Should an oven fire occur, leave the oven door closed and
turn off the oven. If the fire continues, throw baking soda
on the fire or use a fire extinguisher. DO NOT put water
or flour on the fire. Flour may be explosive and water can
cause a grease fire to spread and cause personal injury.
Always use this cooking mode with the oven door closed
or the convection fan will not turn on. ...........................................
Electric Oven Convection Broilina Table Recommendations
Steak 1" thick 4th 550 ° F 6:00 4:00 Rare
Pork Chops 3/4" thick 4th 550 ° F 8:00 6:00 Well
Shrimp 3rd 550 ° F 5:00 - Well
....................................................................................................................................................................................................................................................................................................S ..........................................................................................................................................................................................8100......................................................................................................We,.........................................................
background
SETTING BAKE TIME
Bake Time allows the oven to be set to cook for a specific
length of time and shut off automatically.
The oven will shut off and will beep when the countdown
is finished. This feature can be used with Bake, Convection
Bake, Convection Roast, Pizza and Chicken Nuggets cooking
modes.
To program the oven to begin baking immediately
and to shut off automatically (example: BAKE at
350°F for 30 minutes):
1. Be sure the clock is set for the correct time of day.
2. Arrange interior oven rack(s) and place the food in the
oven.
3. Press BAKE, "350" will appear in the display.
4. Press START. The actual oven temperature will appear
in the display.
5. Press BAKE TIME." .... " will appear in the display.
6. Enter the desired baking time by pressing 30.
7. PressSTART. Once the Timed Bake feature has started,
the current time of day will appear in the display.
Baking time can be set for any amount of time between
1 minute to 6 hours. The time remaining can be shown in
the timer section of the display by pressing BAKE TIME
at any moment of the cooking.
Press CANCEL when baking has finished or at any time to
cancel the Timed Bake feature. A Bake Time of "0" minute
can also be entered to cancel the Bake Time feature and
keep the oven in its current cooking mode.
After the Timed Bake feature has activated, press BAKE
TIME to display the bake time remaining in the Bake Time
mode. Once Bake Time has started baking, a beep will sound
when the oven temperature reaches the set temperature.
When the timed bake finishes:
1. "End" and the time of day will show in display. The
oven will shut off automatically.
2. The control will beep 3 times. The control will continue
to beep 3 times every 30 seconds until CANCEL is
pressed.
SETTING DELAY START
The BAKE, CONVECTION BAKE1 BAKE TIME and DELAY
START pads control the Delayed Time Bake feature. The
automatic timer of the Delayed Time Bake will turn the oven
on and off at the time you select in advance.
If your clock is set for normal 12 hour display mode the
Delayed Timed Bake or Delayed Timed Convection Bake
cycle can never be set to start more than 12 hours in
advance. To set for Delayed Timed Bake or Delayed Timed
Convection Bake 12-24 hours in advance set the control
for the 24 hour time of day display mode.
To program the oven for a delayed BAKE start time
(example: baking at 375°1=, starting at 5:30):
1. Be sure that the clock is set with the correct time of day.
2. Arrange interior oven rack and place the food in the oven.
3. Press BAKE. "350" will appear in the display.
4. Enter the desired temperature; pressing 3 7 5.
5. Press START. The actual oven temperature will appear
in the display.
6. Press DELAY START.
7. Enter the desired start time; pressing 5 3 0.
8. Press START. When Delayed Time Bake starts, the set
oven temperature will appear, "DELAY", "BAKE" and the
current time of day will appear in the display.
If it is desired to have the oven shut off automatically after
a set time; enter a BAKE TIME at this step.
7. When the desired start time is reached, the actual
oven temperature appears in display and "DELAY"
disappears. Oven starts to bake at the previously selected
temperature.
Press CANCEL when baking has completed or at any time
to cancel the Delayed Time Bake feature.
Use caution with the DELAY START features. Usethe automatic timer when cookingcured or frozen meats and most fruits
and vegetables. Foods that can easily spoil such as milk, eggs, fish, meat or poultry, should be chilled in the refrigerator
first. Even when chilled, they should not stand in the oven for more than 1 hour before cooking begins, and should be
rem0ve ro ly when €°°ki ng! s€°m pleted Eatin oiIe food can resu It in sickne ss fro odpois ..........................................................
background
SETTING KEEP WARM
This mode is best for keeping oven baked foods warm for
serving after cooking has finished. The KEEP WARM pad
turns ON the Keep Warm feature and will maintain an oven
temperature of 170°F (77°C). The Keep Warm feature will
keep oven baked foods warm for serving up to 3 hours
after cooking has finished. After 3 hours the Keep Warm
feature will shut the oven OFF. The Keep Warm feature
may be used without any other cooking operations or can
be set to turn ON automatically after a BAKE TIME or
DELAYED BAKE TIHE.
Keep Warm Tips:
e Always start with hot food.
e Do not use the Keep Warm feature to heat cold food.
e Food in heat-safe glass and glass ceramic containers
may need higher temperature settings compared to
food in regular containers.
e Avoid repeated openings of the oven, it will allow hot air
to escape and the food to cool.
e Aluminum foil may be used to cover food to increase
moisture content.
To set Keep Warm:
1. Arrange interior oven racks and place food in oven.
2. Press KEEP WARM. "HLd" will appear in the display.
Note: If no pad is touched within 25 seconds the
request to turn ON Keep Warm feature will be
cancelled.
3. Press START. The oven icon will appear in the display.
4. To turn OFF the KEEPWARM at any time press
CANCEL.
To set Keep Warm to turn ON automatically:
1. Arrange interior oven racks and place food in oven.
Set the oven properly for Bake Time or Delayed
Bake Time. (See their respective sections for more
details).
2. Press KEEP WARM.
Note: If no pad is touched within 25 seconds, the
request to turn ON Keep Warm feature will be
cleared.
3. Press START. "HLd" will disappear and the
temperature will be displayed. The Keep Warm mode
is set to turn ON automatically after Timed Bake has
finished.
4. To turn the Keep Warm feature OFF at any time press
CANCEL.
PressingCANCEL will stop the feature at any time.
SETTING PIZZA (some models)
The PIZZA pad has been designed to give optimum cooking
performance when cooking your favorite pizza. The Pizza
pad let you choose a preset between a frozen pizza (425°F)
and a fresh pizza (400°F). If needed, a different target
temperature than the presets can be entered. Some fresh
pizza request using a broil feature for a few minutes, but
this is not part of the Pizza pad presets.
Pizza Tips:
e Follow the instructions on the box for preheating and
baking times.
• For optimum cooking results, only bake one pizza at
once on rack position 2.
• Check the pizza at 75% of the maximum cook time
listed on the package.
To set Pizza for a frozen pizza:
1. Arrange interior oven racks.
2. Press PIZZA pad. "Fro" will appear in the display. ]:f a
different temperature than 425°F is needed, enter the
temperature now, using the keypad digits.
3. Press START. The fan icon and the actual oven
temperature will appear in the display.
4. Place the pizza in the oven when the beep is heard.
5. [f needed, enter a BAKE TIME (see itssection for further
details).
6. To turn OFF the Pizza feature at any time press
CANCEL.
To set Pizza for a fresh pizza:
1. Arrange interior oven racks.
2. Press PIZZA pad twice. "Frh" will appear in the display.
[f a different temperature than 400°F is needed, enter
the temperature now, using the keypad digits.
3. Press START. The fan icon and the actual oven
temperature will appear in the display.
4. Place the pizza in the oven when the beep is heard.
5. [f needed, enter a BAKE TIlE (see itssection for further
details).
6. To turn OFF the Pizza feature at any time press
CANCEL.
background
SETTING CHICKEN NUGGETS
The CHICKEN NUGGETS pad has been designedto give
optimum cooking performance when cooking your favorite
chicken nuggets. The Chicken Nuggets pad is preset for a
Convection Bake at (400°F) with a Bake Time of 18 minutes,
ending with a Keep Warm setting. If needed, a different
target temperature or Bake Time than the presets can be
entered.
Chicken Nuggets Tips:
- For most type of chicken nuggets,preheatingis not
requiredand the presetbakingtime of the featurewill
giveyou optimum results.
- For larger chicken tenders, follow the preheating and
baking instructions on the box and only use a single
rack.
- For a single rack, use rack position 2.
For multiple racks, use rack positions 2 and 4.
To set Chicken Nuggets;
1. Arrangeinterioroven racksand placefood inoven.
2. PressCHICKEN NUGGETS pad."CHr'willappearinthe
display. Ira different temperature than 400°F is needed,
enter the temperature now, using the keypad digits. If a
different Bake Time than 18 minutes is required, press
BAKE TIME and enter the desired time (or 0 for an
untimed baking).
3. Press START. The fan icon will appear in the display.
4. To turn OFF the Chicken Nuggets feature at any time
pressCANCEL.
The Chicken Nuggets feature is automatically programmed
to activate the Keep Warm feature when the cooking is
finished."HLl)"will be displayed for a maximum of 3 hours.
See the Keep Warm feature for more information.
ii i!
SETTING MY FAVORITE (some models)
The My Favoritesettingallow you to save your most
frequentlyused OF most complex cookingsequence.This
Featurewillsavethe cookingmode, thetargettemperature
and the bake time (if any). The oven can recall a cooking
sequences from its internal memory, which is easily
accessible from a one touch button. This function can be
used with Bake, Convection Bake, Convection Roast and
Preheat.
To save a Favorite (exampleisa 450°F Bake for30
minutes):
i. PressBAKE. The defaulttemperaturewillappearinthe
display.
2. Enter temperature needed; 4 5 O.
3. Press START.
4. Press BAKE TIME.
5. Enter time needed; 3 O.
6. Press START.
7. Press and hold for 3 seconds MY FAVORITE pad.
To recalla Favorite:
i. Press MY FAVORITE pad.
2. Press START.
Recalling a Favorite can only be done when the oven is
not currently in operation.
To overwrite a Favorite-"
1. To overwrite My Favorite simply start a new cooking
sequence and save it as shown in example above. The
new My Favorite settings will overwrite the old ones.
To delete a Favorite:
i. Pressthe MY FAVORITE pad to deletefor3 seconds
whiletheoven isnotinoperationand no cookingmode
has been set.
background
SETTING BROIL
This mode is best for meats, fish and poultry up to 1"
thick. Broiling is a method of cooking tender cuts of meat
by direct heat under the broil element of the oven. The
high heat cooks quickly and gives a rich, brown outer ap-
pearance. The BROIL pad controls the Broil feature. An
optional Searing Grill, Broiler Pan and Insert are available
via the enclosed accessories brochure (Figure 2 & 3). The
optional broil pan and broil pan insert used together allow
dripping grease to drain and be kept away from the high
heat of the oven broiler. The oven can be programmed
to broil at any temperature from 400°F to 550°F with a
default temperature of 550°R
Broiling Tips:
-For optimum browning, preheat the broil element for 5
minutes.
-Broil one side until the food is browned; turn and cook
on the second side. Season and serve.
-Always pull the rack out to the "stop" position before
turning or removing food.
-Always use the broiler pan and its cover when broiling.
It allows the dripping grease to be kept away from the
high heat of the broil element (see Figure 2).
-For best broiling results, broil with the oven door in the
broil stop position (see Figure 1).
- If using a Searing Grill (available by mail order), preheat
the grill for 5 to 10 minutes before placing your meat.
- DO NOT use the broil pan without the insert. DO NOT
cover the broil pan insert with foil, The exposed
grease could catch fire.
Accessories available via the enclosed brochure:
Searing
Broiler
Pan
_ _ Broiler Pan
& 1nse_
Figure 2 Figure 3
Electric Oven BroilinQ Table Recommendations
To
1.
.
3.
4.
.
6.
7.
.
.
set a Broil of 500°F:
Placethe broiler pan inserton the broiler pan. Then place
the food on the broiler pan insert. DO NOT use the broiler
pan without the insert. DO NOT cover the broiler insert
with foil. The exposed grease could ignite.
Arrange the interior oven rack.
Press BROIL. "550" will appear in the display.
Press 5 0 0. If a lower broil temperature is desired
(minimum broil temperature setting is 400°% press
the desired temperature before continuing to step 5.
Press START. The oven will begin to broil. "500 °" will
appear in the display.
Preheat for 5 minutes before broiling.
Place the broiler pan on the rack. Be sure to center the
broiler pan directly under the broiler element. Hake
sure the oven door is in the broil stop position
(See Figure 1),
Broil on one side until
food is browned; turn
and cook on the second
side. Season and serve.
/
Note" Always pull the Broil Stop Position/
rack out to the stop Figure1 .........
/
position before turning
or removing food.
To stop broiling press CANCEL.
Toassure you r electronic controls safety when broiling with
the oven door in broil position, an high speed cooling fan
will blow air through the trims above the door(s).
Should an oven fire occur, leave the oven door closed and
turn off the oven. If the fire continues, throw baking soda
on the fire or use a fire extinguisher. DO NOT put water
or flour on the fire. Flour may be explosive and water can
cause a grease fire to spread and cause personal injury.
Steak 2' thick 4th 550 ° F
Pork Chops 3/4" thick 4th 550 ° F
6:00 4:00 Rare
8:00 6:00 Well
Shrimp 3rd 550 ° F
5:00
4th 550 ° F 10:00 8:00 Well
background
SETTING THE SABBATH FEATURE (for use on
the Jewish Sabbath & Holidays)
The BAKE TIME and DELAY START pads are used to
set the Sabbath feature. The Sabbath feature may only be
used with the BAKE pad. The oven temperature may be
set higher or lower after setting the Sabbath feature (the
oven temperature adjustment feature should be used only
during Jewish Holidays), however the display will not visibly
show or provide any audible tones indicating whether the
change occurred correctly. Once the oven is properly set
using Bake with the Sabbath feature active, the oven will
remain continuously ON until cancelled. This will override
the factory preset 6-Hour Energy Saving feature.
If the oven light will be needed during the Sabbath, press
OVEN LIGHT _ before activating the Sabbath feature.
Once the oven light is turned ON and the Sabbath feature
is active, the oven light will remain ON until the Sabbath
feature is turned OFF. If the oven light needs to be OFF,
be sure to turn the oven light OFF before activating the
Sabbath feature.
To Program the Oven to Begin Baking Immediately &
activate the Sabbath feature (example: baking at 350°F)
1. Be sure that the clock is set with the correct time of day.
2. Place the food in the oven.
3. Press BAKE. "350 °" appears in the display.
4. Press START. The actual oven temperature appears in
the display.
5. If you desire to set the oven control for a Bake Time
or Delayed Bake Time do so at this time. If not, skip
this step and continue to step 7. Refer to the Bake
Time / Delay Start section for complete instructions.
Remember the oven will shut down after using Bake
Time or Delay Start and therefore may only be used
once during the Sabbath/Jewish HoLidays.The maximum
Delayed Start Bake time is 11 hours & 59 minutes.
6. The oven will turn ON and begin heating,
7. Press and hold both the BAKE TIME and DELAY
START pads for at least 3 seconds. "SAb" will appear
in the display. Once "SAb" appears in the display the
oven control will no longer beep or display any further
changes and the oven is properly set for the Sabbath
feature.
8. The oven may beturned OFFat any time by first pressing
CANCEL pad (this will turn the oven OFF only). To turn
OFF the Sabbath feature press and hold both the BAKE
TIME and DELAY START pads for at least 3 seconds,
"SAb" will disappear from the display,
It is not advised to attempt to activate any other program
feature other than BAKE while the Sabbath feature is
active. ONLY the following key pads will function after
setting the Sabbath feature; O to 9, BAKE, START &
CANCEL, All other keypads should not be used once
the Sabbath feature is properly activated.
You may change the oven temperature once baking has
started by pressing BAKE, the numeric key pads for the
temperature you want (example for 425°C press 4 2 5)
and then pressing START twice (for Jewish Holidays
only). Remember that the oven control will no longer
beep or display any further changes once the oven
is set for the Sabbath feature.
Should you experience a power failure or interruption, the
oven will shut off. When power is returned, "SF" (Sabbath
Failure) will be shown in the oven display and the cooktop
displays. The oven and cooktop will not turn back on
automatically. If your food was nearly fully cooked, you
may allow the trapped heat in the oven to finish the cooking
process. Otherwise, you should remove the food when the
power failure occurs, because you may only start the oven
once during the Sabbath/Jewish Holidays. After the Sabbath
observance, turn OFF the Sabbath feature and be sure that
all the control knobs are at the OFF position. The appliance
may be used again with all normal functions.
After the Sabbath observance turn OFF the Sabbath feature.
Press and hold both the BAKE TIHE and DELAY pads for at
least 3 seconds. "SAb" will disappear from the display and
the oven may be used with all normal functions. For further
assistance, guidelines for proper usage, and a complete list
of models with the Sabbath feature, please visit the web at
http: \\www.star=k.org.
How the Electronic Surface Element Controls
work when the Sabbath feature is ON,
(model 8 & C only)
When your Oven Sabbath feature is ON, the Electronic
Surface Elements are also in Sabbath mode. This means
that all electronic surface element control displays show
"Sb': The surface elements can be used even if the Sabbath
Feature is on.
To turn ON a Surface Element when the Oven Sabbath
Feature is active:
If you turn on a surface element when the oven Sabbath
feature is on, the electronic surface element control will record
that request and execute it with a 15-30 seconds delay. So
the element will start heating 15-30 seconds after the surface
element control was turned on. As the oven control, the
surface element display will not show the setting because
"Sb" is on in the displays. When necessary, it is possible to
adjust the power of the surface element but you have to
remember that the surface element control will adjust the
temperature with the same delay.
To turn OFF the Surface Element when the Oven
Sabbath Hode is active:
To shut off the surface element while the Sabbath feature
is ON, proceed as usual but take note that the element will
immediately turn off without any delay.
background
ADJUSTING OVEN TEMPERATURE
The temperature in the oven has been pre-set at the
factory. When first using the oven, be sure to follow recipe
times and temperatures. If you think the oven is cooking
too hot or too cool for the temperature you select, you
can adjust the actual oven temperature to be more or less
than what is displayed. Before adjusting, test a recipe by
using a temperature setting that is higher or lower than the
recommended temperature. The baking results should help
you to decide how much of an adjustment is needed.
The oven temperature adjustments made with this feature
will not change the Self=Cleancycle temperature or the Broil
temperature.
To adjust the oven temperature higher
1. Press BAKE for 6 seconds. "UPO 0" will appear in the
display.
2. To increasethe temperature use the number pads to enter
the desired change (Example 30°F) 30. The temperature
may be increased as much as 35°F (19°C).
3. Press START to accept the temperature change and the
display will return to the time of day. Press CANCEL to
reject the change if necessary.
To adjust the oven temperature lower
1. Press BAKE for 6 seconds. 0 ° will appear in the
display.
2. To decrease the temperature use the number pads to
enter the desired change (Example -30°F) 30 and then
press SELF CLEAN. The temperature may be decreased
as much as 35°F (19°C).
3. Press START to accept the temperature change and the
display will return to the time of day, Press CANCEL to
reject the change if necessary,
OVEN LIGHT
The oven isequipped with 2 oven lights. The oven lights will
turn on automatically, when the oven door is opened.
The oven light may be turned on when the door is closed by
using the oven light pad located on the control panel. The
oven light key will toggle the lights at full intensity.
To toggle the Oven Lights ON and OFF:
1. Press OVEN LIGHT _,
The interior oven lights are covered with a glass shield held
by a wire holder. The glass shield must be in place whenever
the oven is in use.
To change the interior oven lights, see "Changing the oven
light" in the Care & Cleaning section.
The oven temperature adjustments are permanent and
will stay forever in the unit memory unless you manually
change it again. Even a power outage will not reset these
changes. Follow the same procedure again if you wish to
change it to a different setting.
background
Self-cleaning
A self-cleaning oven cleans itself with high temperatures
(well above normal cooking temperatures) which
eliminate soils completely or reduces them to a fine
powdered ash you can wipe away with a damp cloth.
Adhere to the following cleaning precautions:
• DO NOT use oven cleaners or oven protective
coatings in or around any part of the oven interior.
• DO NOT clean the oven door gasket. The woven
material of the oven door gasket is essential for a
good seal. Care should be taken not to rub, damage
or remove the gasket.
• DO NOT use any cleaning materials on the oven
door gasket. Doing so could cause damage.
• Remove the broiler pan and insert, all utensils
and ANY ALUNINUM FOIL. These items cannot
withstand high cleaning temperatures and will melt.
• Completely remove ALL OVEN RACKS and
ANY ACCESSORIES. If the oven racks are not
removed, they will lose their special coating
properties and will no longer slide in and out
of the oven cavity effortlessly.
• Remove any excessive spUlovers in the oven
cavity before starting the Self-Cleaning cycle. To
clean, use hot, soapy water and a cloth. Large
spillovers can cause heavy smoke or fire when
ii
subjected to high temperatures. DO NOT allow food
ii
spills with a high sugar or acid content (such as milk,
tomatoes, sauerkraut, fruit juices or pie filling) to
remain on the surface as they may leave a dull spot
even after cleaning.
ii
® Clean any soil from the oven frame, the door liner
outside the oven door gasket and the small area at
ii
the front center of the oven bottom. These areas heat
ii
sufficiently to burn soil on. Clean with soap and water.
What to Expect during Cleaning
While the oven is in operation, the oven heats to
temperatures much higher than those used in normal
cooking. Sounds of metal expansion and contraction
are normal. Odor is also normal as the food soil is being
removed. Smoke may appear through the oven vent.
If heaw spillovers are not wiped up before cleaning, they
may flame and cause more smoke and odor than usual.
This is normal and safe and should not cause alarm. If
available, use an exhaust fan during the self-cleaning
cycle.
To avoid possible burns use care when opening the
oven door after the SelFCleaning cycle. Stand to the
side of the oven when opening the door to allow hot air
or steam to escape.
During the Self-Cleaning cycle, the outside of the range
can become very hot to the touch. DO NOT leave
small children unattended near the appliance.
The health of some birds is extremely sensitive to the
fumes given off during the SelFCleaning cycle of any
range. Nove birds to another well-ventilated room.
DO NOT line the oven walls, racks, bottom or any
other part of the range with aluminum foil. Doing
so will destroy heat distribution, produce poor baking
results and cause permanent damage to the oven
interior (aluminum foil will melt to the interior surface
of the oven).
DO NOT force the oven door open. This can damage
the automatic door locking system. Use caution when
opening the door after the Self-Cleaning cycle is
........c°mpleted he ove e VERY HOT-............................................................................................
DO HAND
CLEAN FRAME
See additional cleaning information for the oven door in
the General Care & Cleaning section.
DO HAND
CLEAN DOOR
DO NOT HAND
CLEAN OVEN
DOOR GASKET
background
SETTING SELF-CLEAN CYCLE TIME LENGTH
The SELF CLEAN pad controls the Self-Cleaning feature. If
you are planning to use the oven directly after a self-clean
cycle remember to allow time for the oven to coo! down
and the oven door to unlock. This normally takes about one
hour. So a 3 hour self-dean cycle will actually take about
4 hours to complete.
*It is recommend to use a 2 hour self-clean cycle for light
soils, a 3 hour cycle for average soils, and a 4 hour cycle
for heavy soils (to assure satisfactory results).
To set the controls for a 3 hour Self=Cleaning cycle
to start immediately and shut off automatically
1. Be sure the dock isset with the correct time of day and
the oven door is closed.
2. Press SELF CLEAN. "CLn" and "3:00" HR will show
in the display. The contro! will automatically clean for
a 3 hour period (default self-cleaning cycle time).
If a 2 or 4 hour clean time is desired, press SELF CLEAN
multiple times to toggle between 2, 3 or 4 hours.
.
.
Press START. "door Loc" will appear, a beep will sound
and the"DOOR" and I_1icon will flash; the letters"CLn"
will remain on in the display.
As soon as the contro! is set, the motor driven oven
door lock will begin to close automatically. Once the
door has been locked the "DOOR" indicator light and
icon will stop flashing and remain on. Also, the oven
icon will appear in the display.
The SELF CLEAN and DELAY START pads controls the
Delayed Self-Clean operation. The automatic timer will turn
the oven on and off at the time you select in advance.
To set the control for the Self=Cleaning Cycle to
start at a delayed time and shut off automatically
(example: 3 hour self=clean cycle to start at 4:30)
1. Be sure the clock is set with the correct time of day and
the oven door is closed.
2. Press SELF CLEAN. "CLn" and "3:00" HR will show
in the display. The control will automatically clean for
a 3 hour period.
If a 2 or 4 hour clean time is desired, press SELF CLEAN
multiple times to toggle between 2, 3 or 4 hours.
3. Press START. "door Loc" will appear, a beep will sound
and the"DOOR" and I_1iconwill flash; the letters"CLn"
will remain on in the display.
4. Press DELAY START. Enter the desired start time using
the number pads 4 30.
5. Press START. "DELAY", "DOOR" and I_1 icon icons
will remain on.
6. As soon as the control is set, the motor driven oven door
lock will begin to close automatically. Once the door has
been locked the "DOOR" and I_1icon indicator light will
quit flashing and remain on.
7. The control will start the self-cleaning at the set start
time, for the period of time previously selected. At that
time, the icon "DELAY" will go out; "CLn" and oven
icon will appear in the display.
[i
Allow about 15 seconds for the oven door lock to close.
When the Self-Clean Cycle is Completed
1. "HOT" will appear in the display. The time of day, the
"DOOR" and I_1icon will remain in the display.
2. Once the oven has cooled down for approximately 1
HOUR, "door OPn" will appear and the "DOOR" and
I_1icon will flash until the door is unlocked, the oven
door can then be opened and the timer will revert back
to the time of the day.
Stopping or Interrupting a Self=Cleaning Cycle
If it becomes necessary to stop or interrupt a self-cleaning
cycle due to excessive smoke or fire in the oven:
1. Press CANCEL.
2. The oven door can only be opened after the oven has
cooled down for approximately 1 HOUR, "door OPn"
will appear and the "DOOR" and I_1icon will flash until
the door is unlocked, the oven door can then be opened
and the timer will revert back to the time of the day.
When the Self-Clean Cycle is Completed
1. "HOT" will appear in the display. The time of day, the
"DOOR" and I_! icon will remain in the display.
2. Once the oven has cooled down for approximately 1
HOUR, "door OPn" will appear and the "DOOR" and
I_1icon will flash until the door is unlocked, the oven
door can then be opened and the timer will revert back
to the time of the day.
Stopping or Interrupting a Self=Cleaning Cycle
If it becomes necessary to stop or interrupt a self-cleaning
cycle due to excessive smoke or fire in the oven:
1. Press CANCEL.
2. The oven door can only be opened after the oven has
cooled down for approximately 1 HOUR, "door OPn"
will appear and the "DOOR" and I_1icon will flash until
the door is unlocked, the oven door can then be opened
and the timer will revert back to the time of the day.
background
Keep warm drawer rack positions
The rack can be used in 2 ways:
- In the upright position (Figure 1) to allow low
profile food items to be placed both under and on top
of the rack (for example, rolls or biscuits on top of
the rack and a casserole dish underneath).
- In the downward position (Figure 2) to allow you
to place light weight food items and empty dishware
(for example, rolls or pastries and dinner plates) on
the rack.
Set the keep warm drawer rack in either position.
Figure 1
=
Note" For best results, preheat the keep warm drawer
before adding the food. An empty drawer will preheat
in approximately 15 minutes.
When the food is ready for removal,
touch the oneoff pad once to turn
the keep warm drawer OFF. The
keep warm drawer indicator light will
turn OFF.
m hi 1::_hi [::_hi
m
keep warm
drawer
hi
M
i reed
[] reed [] med _ med
[] low [] low [] low
Figure 3 Figure 4 Figure 5 Figure 6
Operating the keep warm drawer
The purpose of the keep warm drawer is to keep hot
cooked foods at serving temperature. Always start with
hot food. It is not recommended to heat cold food in
the keep warm drawer. All food placed in the keep warm
drawer should be covered with a lid or aluminum foil to
maintain quality. Do not use plastic wrap to cover food.
Plastic may melt onto the drawer and be very difficult to
clean. Use only utensils and cookware recommended for
oven use in the keep warm drawer.
Always use potholders or oven mitts when
removing food from the keep warm drawer as cookware
and plates will be hot and you can be burned.
To set the keep warm drawer controls
The control and indicator lights for the keep warm
drawer features are located on the control panel. The
temperatures are approximate, and are designated by HI
(high), NED (medium) and LO (low).
1, Touch the onooff pad (see Figure 6) at the keep
warm drawer control position. The keep Warm drawer
indicator light will flash. Note: If no further pads are
touched within 25 seconds the request to power the
keep warm drawer ON will clear.
2. Set the desired power level. Touch A once to turn ON
the power level for HI (see Figure 3) or v to turn ON
the power level for LO (see Figure 5). The keep warm
drawer indicator light located beside the onooff pad
will turn ON steady.
3, Each touch of the v or A pads will decrease or
increase through 5 power levels from HI (see Figure
3) to NED (see Figure 4) to LO (see Figure 5).
The keep warm drawer is inoperable during the self-
clean cycle.
The keep warm drawer is equipped with a latch which
may require extra force when opening and closing the
drawer,
Keep warm drawer temperature selection
Recommended keep warm drawer settings table is shown
below. If a particular food is not listed, start with the
NED setting. If more crispness is desired, remove the lid
or aluminum foil from the food. Most foods can be kept
at serving temperatures on the NED setting. When a
combination of foods are to be kept warm (for instance,
meat with 2 vegetables and rolls), use the HI setting. To
avoid heat loss, do not open the keep warm drawer while
in use.
Food lrtem Setting
Bacon, Hamburger Patties HI
Poultry, Pork Chops HI
Fried Foods, Pizza HI
Gravies, Casseroles lED
Vegetables, Eggs NED
Roasts (Beef, Pork, Lamb) MED
Biscuits, Pastries NED
........Rolls,hard ..................................................................................................................................................................................................................................................................................MED.....
Rolls (soft) LO
Empty Dinner Plates LO
background
Cleaning various parts of your appliance
Before cleaning any part of the appliance, be sure all controls are turned off and the appliance is COOL. REMOVE
SPILLOVERS AND HEAVY SOILING AS SOON AS POSSIBLE. REGULAR CLEANING WILL REDUCE THE NUMBER OF
MAJOR CLEANING LATER.
Aluminum (trim pieces) & Use hot, soapy water and a cloth. Dry with a clean cloth.
Vinyl
Glass, Painted and Plastic Using a soft cloth, clean with mild dish detergent and water or a 50/50 solution of vinegar
Body Parts, Control Knobs and water. Follow by rinsing the area with clean water; dry and polish with a soft cloth.
& Decorative Trim Pieces Glass cleaners may be used if sprayed on a soft cloth first. DO NOT spray liquids directly
on the contro! pad and display area. Do not use large amounts of water on the control
panel - excess water on the control area may cause damage to the appliance. Do not
use other liquid cleaners, abrasive cleaners, scouring pads, or paper towels - they will
damage the finish. To remove control knobs, turn to the OFF position; grasp firmly and
pull straight off the shaft. To replace knobs after cleaning, line up the fiat sides of both
Control Panels Before cleaning the control panel, turn all controls to OFF and remove the control
knobs. To remove, pull each knob straight off the shaft. Clean as instructed above.
Squeeze excess water from the cloth before wiping the panel; especially when wiping
around the controls. Excess water in or around the controls may cause damage to the
appliance. To replace knobs after cleaning, line up the fiat sides of both the knob and
the shaft; then push the knob into place.
Porcelain Enamel Clean burner grates, broiler pan and insert (some models) in the dishwasher and dry
Burner Grates, Cooktop upon removal. If soils are not removed, follow the cooktop cleaning instructions below.
Surface, Below Cooktop, Gentle scouring with a soapy scouring pad will remove most spots. Rinse with a
Broiler Pan & Insert (some 1:1 solution of clear water and ammonia. If necessary, cover difficult spots with an
models), Door Liner, Oven ammonia-soaked paper towel for 30 to 40 minutes. Rinse with clean water and a damp
Bottom & Burner Drip Pans cloth, then scrub with a soap=fifled scouring pad. Rinse and wipe dry with a clean cloth.
Remove all cleaners or the porcelain may become damaged during future heating. DO
ii
........... NOT use spray oven cleaners on the cooktop. ...................
Easy CareTM Stainless Your range finish is may be made with Easy CareTM Stainless Steel (some models).
Steel (some models) Oven Clean the stainless with warm soapy water using a dean sponge or cloth. Rinse with
Door & Drawer Front Panel clean water and dry with a soft clean cloth. DO NOT use ANY store bought cleaners
and Decorative Trim like Stainless Steel cleaners or any other types of cleaners containing any abrasive,
chlorides, chlorines or ammonia. It is recommended to use mild dish soap and water or
ii
;Oven Racks Remove racks. See <<Toremove and to replace an oven rack>>under Oven vent(s) and
ii
racks. Use a mild, abrasive cleaner, following manufacturer's instructions. Rinse with
clean water and dry. After cleaning the racks, rub the sides of the racks with wax paper
or a cloth containing a small amount of baby oil or salad oil (this will make the racks
glide easier into the rack positions).
Oven Door
N FRAME
NOT HAND
CLEAN OVEN
\.LJ__ DOOR GASKET
DO HAND
CLEAN DOOR
ii
Use soap & water to thoroughly clean the top, sides and front of the oven door. Rinse
well. You may use a glass cleaner on the outside glass of the oven door. DO NOT
immerse the door in water. DO NOT spray or allow water or the glass cleaner to enter
the door vents. DO NOT use oven cleaners, cleaning powders or any harsh abrasive
cleaning materials on the outside of the oven door.
55NSTdeantileovendoorgasketlTileovendoorgasketismadeofawoven
material, on Self-Cleaning models, which is essential for a good seal. Care should be
taken not to rub, damage or remove this gasket.
background
Ceramic glass cooktop cleaning &
maintenance
Consistentand to
maintaining your Ceramic g|ass cooktop,
Prior to using your cooktop for the
first time, apply the recommended
CERAMA BRYTE® Cleaning Creme to
the ceramic surface. Clean and buff
with a non abrasive cloth or pad. This
will make cleaning easier when soiled
from cooking. The special cooktop
cleaning cream leaves a protective
finish on the glass to help prevent
scratches and abrasions.
Sliding aluminum or copper clad
bottom pans on the cooktop can
....Ci -RA A
V
cause metal markings on the cooktop surface. These
marks should be removed immediately after the
cooktop has cooled using the cooktop cleaning cream.
Metal marks can become permanent if not removed prior
to future use.
Cookware (cast iron, metal, ceramic or glass) with rough
bottoms can mark or scratch the cooktop surface. Do
not slide anything metal or glass across the cooktop.
Do not use your cooktop as a cutting board or work
surface in the kitchen. Do not cook foods directly on the
cooktop surface without a pan. Do not drop heavy or
hard objects on the glass cooktop, or they may crack it.
Cleaning recommendations for the
ceramic glass cooktop
Before cleaning the cooktop, be sure the controls are
turned to OFF and the cooktop is COOL,
DO NOT use a cooktop cleaner on a hot cooktop.
The fumes can be hazardous to your health, and can
chemically damage the ceramic glass surface.
For light to moderate soil"
Apply a few drops of CookTop® Cleaning Creme directly
to the cooktop. Use a paper towel or use a non=
abrasive plastic type no=scratch pad to clean the
entire cooktop surface. Make sure the cooktop is cleaned
thoroughly, leaving no residue.
For heavy, burned on soil"
Apply a few drops of CookTop® Cleaning Creme directly
to the soiled area. Rub the soiled area using a non=
abrasive plastic type no=scratch pad, applying pressure
as needed. Do not use the pad you use to clean the
cooktop for any other purpose.
Damage to the ceramic glass cooktop may occur if you
use an abrasive type scratch pad. Only use cleaning
products that have been specifically designed for
ceramic glass cooktop.
If soils remain, carefully scrape soils with a metal razor
blade scraper, holding scraper at a 30 degree angle to the
surface. Remove loosened soils, then apply a few drops
of cleaning cream and buff surface clean.
/
/
background
Cleaning recommendations for the
ceramic glass cooktop (continued)
Plastic or foods with a high sugar content:
These types of soils need be removed immediately if
spilled or melted onto the ceramic cooktop surface.
Permanent damage (such as pitting of the cooktop
surface) may occur if not removed immediately. After
turning the surface elements OFF, use a razor blade
scraper or a metal spatula with a mitt and scrape the soil
from the hot surface (as illustrated). Allow the cooktop to
cool, and use the same method for heavy or burned on
soils.
Do not use the following on the ceramic glass
cooktop:
• Do not use abrasive cleaners and scouring pads,
such as metal and some nylon pads, They may
scratch the cooktop, making it more difficult to
clean,
Do not use harsh cleaners, such as chlorine
bleach, ammonia or oven cleaners, as they may
etch or discolor the cooktop,
Do not use dirty sponges, cloths or paper
towels, as they can leave soil or lint on the
cooktop which can burn and cause Special
Caution for Aluminum Foil and Aluminum
Cooking Utensils
• Aluminum foil
Use of aluminum foil will damage the cooktop. Do not
use under any circumstances.
• Aluminum utensils
Since the melting point of aluminum is much lower
than that of other metals, care must be taken when
aluminum pots or pans are used. Pans that boil dry
may permanently damage cooktop by breaking, fusing
to, or marking it.
Care and cleaning of stainless steel
Some models are equipped with stainless steel exterior
parts. Special care and cleaning are required for
maintaining the appearance of stainless parts. Refer
to the General Care 8=Cleaning table for detailed
cleaning instructions.
Removing and replacing the lift-off oven
door
The door is heaw. For safe, temporary storage, lay the
door fiat with the inside of the door facing down.
To Remove Oven Door:
1. Open oven door completely (horizontal with floor -
See Figure 1).
2. Pull the door hinge locks on both left and right
door hinges down from the oven frame completely
towards the oven door (See Figure 2). A tool such as
a small fiat-blade screwdriver may be required.
3. Firmlygrasp both sides of oven door along the door
sides (Do not use the oven door handle - See Figure :3).
4. Close the door to the broil stop position (the oven
door will stop into this position just before fully
closing).
5. With the oven door in the broil stop position, lift the
oven door hinge arms over the roller pins located on
each side of the oven frame (See Figure 4).
To Replace Oven Door:
1. Firmly grasp both sides of oven door along the door
sides (Do not use the oven door handle - See Figure 3).
2. Holding the oven door at the same angle as the
removal position, seat the hook of the hinge arm over
the roller pins located on each side of the oven door
frame (See Figure 4). The hook of the hinge arms
must be fully seated onto the roller pins.
3. Fully open the oven door (horizontal with floor - See
Figure 1).
4. Push the door hinge locks up towards and into the
oven frame on both left and right oven door hinges
(See Figure 2) to the locked position.
5. Close the oven door.
Door Hinge locations
with oven door fully open
Figure 1
Figure 2
background
Oven door =
a
Hinge _ ! !
Figure 3 Figure 4
Special door care instructions - Mostoven
doors contain glass that can break.
Read the following recommendations:
1. Do not close the oven door until all the oven racks are
fully in place.
2, Do not hit the glass with pots, pans, or any other ob-
ject.
3. Scratching, hitting, jarring or stressing the glass may
weaken its structure causing an increased risk of
breakage at a later time.
To remove the "hidden bake" cover
(some models)
I. In order to remove the "hidden bake" cover, pull the
back edge with one hand about 1/2" inch and lift
up the "hidden bake" cover with both hands (See
picture).
2. When reinstalling the "hidden bake" cover, be sure to
put it all the way to the back of the oven and lay it
down on the 2 shoulder screws. Then push the front
edge of the cover in its place below the front bracket.
Changing oven light
Be sure the oven is unplugged and all parts are COOL
before replacing the oven light bulb. Do not turn
the oven light on during a self-cleaning cycle. High
temperature will reduce lamp life.
On some models an interior oven light will turn on
automatically when the oven is opened. The oven light
may be turned on when the door is closed by using the
oven light switch located on the Electronic Oven control.
The oven light bulb is covered with a glass shield held
in place by a wire holder. THIS GLASS SHIELD MUST
ALWAYS BE IN PLACE WHEN THE OVEN IS IN USE.
BESUREOVENISCOOL
To Replace the Light Bulb:
1, Turn the power off at the main source.
2. Wear a leather-faced glove for protection against
possible broken glass.
3. Replace bulb with a 40 Watt appliance bulb only.
4. For self-cleaning oven, press wire holder to one side
to release glass shield, change bulb and be sure to
replace glass shield.
To have easier access to the "hidden bake" cover, you can
remove the oven door by following the instructions on
previous page.
IMPORTANT: Always replace the "hidden bake" cover
before the next use.
background
To remove and replace storage drawer with
extendible glide (some models)
To Remove Storage Drawer
1. Open the drawer to the fully opened position.
2. Locate the latches on both sides of the warmer
drawer.
3. Pull up on the left glide latch and push down on the
right glide latch.
4. Pull the drawer away from the appliance.
To Replace Storage Drawer
1. Align the glide latches on both sides of the drawer
with the slots on the drawer.
2. Push the drawer back into the appliance.
To remove and replace keep warm drawer
(some models)
Turn power off before removing the warmer drawer.
To remove keep warmer drawer
1. Open the drawer to the fully opened position.
2. Locate the latches on both sides of the keep warm
drawer.
3. Pu!l up on the left glide latch and push down on the
right glide latch.
4. Pull the drawer away from the appliance.
5. To clean keep warm drawer, gently scour with a soapy
scouring pad, this will remove most spots. Rinse with a
1:1 solution of clear water and ammonia. If necessary,
cover difficult spots with an ammonia=soaked paper
towel for 30 to 40 minutes. Rinse with clean water and
a damp cloth. Remove all cleaners or the porcelain
may become damaged during future heating. DO NOT
use spray oven cleaners on the cooktop.
To replace keep warm drawer
1. Align the glide latches on both sides of the drawer with
the slots on the drawer.
2. Push the drawer back into the appliance.
Turn the keep warm drawer control knob to OFF before
removing the drawer. DO HOT touch the keep warm
drawer element. The element may still be hot enough
to cause burns, even if it is dark in color. ....
Left Glide
Electrical Shock Hazard can occur
and result in serious injury or death.
Disconnect appliance from electric power
before cleaning and servicing the keep
warm drawer.
background
Oven baking
For best cooking results, heat the oven before baking cookies, breads, cakes, pies or pastries, etc. There is no need to
preheat the oven for roasting meat or baking casseroles.
The cooking times and temperatures needed to bake a product may vary slightly from your previously owned
appliance.
Baking Causes Corrections
Problems
Cookies and o Cookies and biscuits put into • Allow oven to preheat to the selected temperature
biscuits burn on the oven before the preheating before placing food in oven.
the bottom, time is completed.
O
Oven rack overcrowded. Choose pan sizes that will permit 5.1cm to 10.2cm
(2" to 4'3 of air space on all sides when placed in
the oven.
Dark pan absorbs heat too fast. • Use a medium=weight aluminum baking sheet.
Cakes too dark on • Cakes put into the oven before • Allow oven to preheat to the selected temperature
top or bottom, preheating time is completed, before placing food in the oven.
Rack position too high or low, = Use proper rack position for baking needs.
Oven too hot, o Set oven temperature 25°F/12°C lower than
recommended,
Cakes not done in • Oven too hot. • Set oven temperature 25°F/12°C lower than
the center, recommended.
Incorrect pan size. • Use pan size suggested in recipe.
Pan not centered in oven. _ Use proper rack position and place pan so there is
5.1cm to 10.2cm (2" to 4") of space on all sides of
ii
pan.
Cakes not level, • Range not level. • Place a marked glass measuring cup filled with water
ii
on the center of the oven rack, If the water level
is uneven, refer to the installation instructions for
leveling the range.
Pan too close to oven wall or o Be sure to allow 5.1cm to 10.2cm (2" to 4") of
rack overcrowded, clearance on all sides of each pan in the oven,
ii
• Pan warped, • Do not use pans that are dented or warped,
ii
Foods not done • Oven too cool. • Set oven temperature 25°F/12°C higher than
when cooking time suggested and bake for the recommended time.
is up, • Oven overcrowded. • Be sure to remove all pans from the oven except the
ones to be used for baking.
I _ Oven door opened too _ Open oven door only after shortest recommended
_ frequently, baking time,
ii
background
Before you call for service, review this list. It may save you time and expense. The list includes common
occurrences that are not the result of defective workmanship or materials in this appliance.
Range is not level. Poor installation. Place oven rack in center of oven. Place a level on the oven rack. Adjust
leveling legs at base of range until the rack is level. When range is level, cooktop may
appear out of alignment if countertop is not level.
.............................................................................................................................................................................Weak, unstable floor. Be sure floor is level and can adequately support range. If floor is ..............................
sagging or slopping, contact a carpenter to correct the situation.
.....Kitcfieficabifietmisaligfimefitmaymakeiafigeappeartobeufiievei:Besurecabifietsare
square and have sufficient room for range clearance.
Cannot move Cabinets not square or are built in too tight. Contact a cabinet maker to correct the problem.
appliance easily, contact builder or installer to make appliance accessible:
Appliance must .........................................................
be accessible for Carpet interferes with range. Provide sufficient space so range can be lifted over carpet.
service, line is hard-plumbed. Have a flexible CS.A international approved metal appliance .............................
connector installed.
Entire range or oven Make sure cord/plug is plugged tightly into outlet.
does not operate. Service wiring is not complete. Call an authorized servicer. ..........................
Electrical power outage. Check house lights to be sure. Call your local electric company for
service.
Cooktop control Cooktop control has detected a fault or error condition. Try turning electrical power supply
displays any E code OFF and back ON to cooktop in order to reset Cooktop ma_n controls. If fault recurs record
error Models B & C fault number and turn power supply to Cooktop ore
only (ex.: E014)
Oven control beeps Electronic control has detected a fault condition. Press STOP/CLEAR to clear the display and
and displays any F stop beeping. Reprogram oven. [f fault recurs, record fault number. Press STOP/CLEAR and
code error (ex.: Fll) call an authorized servicer for assistance.
Oven light does not Replace or tighten bulb. See Changing Oven Light section in this Use & Care Guide.
work. Electrical power outage. Check house lights to be sure. Call your local electric company for service.
Surface unit does
not heat.
No power to the appliance. Check steps under "Entire Range or Oven Does Not Operate" in
this Before you Call checklist.
[ncorrect control setting. Make sure the correct control is on for the surface unit to be used.
Surface units too Incorrect control setting. Make sure the correct control is on for the surface unit to be used.
hot or not hot Lightweight or warped pans used. Use only flat, evenly balanced, medium or heavyweight
enough, cookware. Flat pans heat better than warped pans. Cookware materials and weight of the
material affect heating. Heavy-and medium- weight pans heat evenly. Because lightweight
pans heat unevenly, foods may burn easily.
Drip bowls are Foodswith acids such as tomatoes, if allowed to stand in/on bowls will cause corrosion.
pitting or rusting. Remove and wash drip bowls as soon as _ossible after spillover.
ii
Normal environment. Houses alone sea coast are exposed to salt air. Protect bowls as much
......... as possible from direct exposure to salt air. .....................
Drip bowls turning Bottom surface of cookware extends be'_ond surface elements and touches cooktop surface.
color or distorted This can cause high enough temperatures to discolor the drip bowls. DO NOT use cookware
out of shape, of this type. Pan sizes should be matched to the size of the element. Re )lacement drip
bowls may be purchased from your dealer.
Metalmarks. Sliding or scrapng of metal utensils on cooktop surface. Do not slide metal utensils on
cooktop surface. Use a ceramic-glass cooktop cleaning cream to remove the marks.
"Cooktop Cleaning - Ceramic Glass Cooktop Models" section under General Cleaning.
background
Scratches or
abrasions on
cooktop surface,
Coarse particles such as salt or sand between cooktop and utensils can cause scratches. Be
sure cooktop surface and bottoms of utensils are clean before usage. Small scratches do not
.........affect cooking and will become less visible with time. ........................
Cleaning materials not recommended for ceramic-glass cooktop have been used. See
"Cooktop Cleaning - Ceramic Glass Cooktop Models" section under General Cleaning.
Cookware with rough bottom has been used. Use smooth, flat-bottomed cookware.
Brown streaks or Boilovers are cooked onto surface. Use razor blade scraper to remove soil. "Cooktop
specks. Cleaning -Ceramic Glass Cooktop Models, section under General Cleaning. ......
Areas of Mineral deposits from water and food. Remove using a ceramic-glass cooktop cleaning
discoloration with cream. Use cookware with clean, dry bottoms.
metallic sheen.
; Poor baking results, Many factors affect baking results. Make sure the proper rack position is used. Center
food in the oven and space pans to allow air to circulate. Allow the oven to preheat to the
set temperature before placing food in the oven. Try adjusting the recipes' recommended
temperature or baking time. If you feel the oven is too hot or coo!, see "Adjusting Your
ii
Oven Temperature" section in the Electronic Oven Control Guide. .....
Fan noise during A cooling fan may automatically turn on and off to cool internal parts. It is normal, and the
cooking operation, fan may continue to run even after oven is turned off.
Flames inside oven Excessive spillovers in oven. Set self-clean cycle for a longer cleaning time.
or smoking from Excessive spillovers in oven. This is normal, especially for pie spillovers or large amounts of
vent.
grease on the oven bottom. Wipe up excessive spillovers before starting the self-clean cycle.
If flames or excessive smoke are present, stop the self-clean cycle and follow the steps
under "Stopping or Interrupting the Self-Cleaning Cycle" in the Electronic Oven Control
Guide.
Oven smokes Control(s) not set properly. Follow instructions under "Setting Oven Controls".
y during Make sure oven is opened to Broil Stop Position.
broiling ................
Meat too close to the element. Reposition the rack to provide proper clearance between the
meat and the element: Preheat broil element. Preheat broi ! element for searing: ....................................................
Grid on broiler pan wrong side up and grease not draining. Always place grid on the broiler
pan with ribs up and slots down to allow grease to drip into pan.
Grease has built up on oven surfaces. Regular cleaning is necessary when broiling
frequently. Old grease or food spatters cause excessive smoking.
Control(s) not set properly. Follow instructions under "Oven Cleaning" in the Electronic Oven
Control Guide.
ii
Self-cleaning cycle Contro!(s) not set properly. Follow instructions under "Oven Cleaning" in the Electronic Oven
does not work, Control Guide.
ii
Self-cleaning cycle was interrupted. Stop time must be 2 to 4 hours past the start time.
Follow steps under "Stopping or Interrupting the Self-Cleaning Cycle" in the Electronic Oven
Control Guide.
Soil not completely Set Self-Clean cycle for a longer cleaning time.
removeda erself- Faiiuretocleafibosomfrontltopofovenordoorareasoutsi eovenseai:Tfieseareas......................................
cleaning cycle, are not in the Self-Cleaning area, but get hot enough to burn on food residue. Clean these
areas before starting the Self-Clean cycle. Burned-on residue may be cleaned with a stiff
nylon brush and water or nylon scrubber. Be careful not to damage the oven gasket.
Excessive smoking Excessive spillovers in oven, especially for pie spillovers or large amounts of grease on the
from oven vent. oven bottom. Wipe up excessive spillovers before starting the SelFClean cycle. If flames or
excessive smoke are present, stop the Self-Clean cycle and follow the steps under "Stopping
or Interrupting the Self-Cleaning Cycle"_ in the Electronic Oven Control Guide.
ii
background
Your appliance is covered by a one year limited warranty. For one year from your original date of purchase, Electrolux
will pay all costs for repairing or replacing any parts of this appliance that prove to be defective in materials or
workmanship when such appliance is installed, used and maintained in accordance with the provided instructions.
Exclusions
If YOU
Need
Service
ii
This warranty does not cover the following:
1. Products with original serial numbers that have been removed, altered or cannot be readily
determined.
2. Product that has been transferred from its original owner to another party or removed outside the
USA or Canada.
3. Rust on the interior or exterior of the unit.
4. Products purchased "as-is" are not covered by this warranty.
5. Food loss due to any refrigerator or freezer failures.
6. Products used in a commercial setting.
7. Service calls which do not involve malfunction or defects in materials or workmanship, or for
appliances not in ordinary household use or used other than in accordance with the provided
instructions.
8. Service calls to correct the installation of your appliance or to instruct you how to use your appliance.
9. Expenses for making the appliance accessible for servicing, such as removal of trim, cupboards,
shelves, etc., which are not a part of the appliance when it is shipped from the factory.
10. Service calls to repair or replace appliance light bulbs, air filters, water filters, other consumable, or
knobs, handles, or other cosmetic parts.
11. Surcharges including, but not limited to, any after hour, weekend, or holiday service calls, tolls, ferry
trip charges, or mileage expense for service calls to remote areas, including the state of Alaska.
12. Damages to the finish of appliance or home incurred during installation, including but not limited to
floors, cabinets, walls, etc.
13. Damages caused by: services performed by unauthorized service companies; use of parts other than
genuine Electrolux parts or parts obtained from persons other than authorized service companies; or
external causes such as abuse, misuse, inadequate power supply, accidents, fires, or acts of God.
DISCLAIMER OF IMPLIES WARRANTIES; LIMITATION OF REMEDIES
Customer's sole and exclusive remedy under this limited warranty shall be product repair or
replacement as provided herein. Claims based on implied warranties, including warranties of
merchantability or fitness for particular purpose, are limited to one year or the shortest period
allowed by law, but not less than one year. Electrolux shall not be liable for consequential or
incidental damages such as property damage and incidental expenses resulting from any breach
of this written limited warranty or any implied warranty. Some states and provinces do not allow
the exclusion or limitation of incidental or consequential damages, or limitations on the duration of
implied warranties, so these limitations or exclusions may not imply to you. This written warranty
gives you specific legal rights. You may also have other rights that vary from state to state.
Keep your receipt, delivery slip, or some other appropriate payment record to establish the warranty period
should service be required. If service is performed, it is in your best interest to obtain and keep all receipts.
Service under this warranty must be obtained contacting Electrolux at the addresses or phone numbers
below.
This warranty only applies in the USA and Canada. In the USA, your appliance is warranted by Electrolux Major
Appliances North America, a division of Electrolux Home Products, Inc. In Canada, your appliance is warranted by
Electrolux Canada Corp. Electrolux authorizes no person to change or add to any obligations under this warranty.
ii
Obligations for service and parts under this warranty must be performed by Electrolux or an authorized service
company. Product features or specifications as described or illustrated are subject to change without notice.
ii
USA
1,800.944.9044
Electrolux Major Appliances
North America
P.O. Box 212378
Augusta, GA 30907
Electrolux
Canada
1.800.265.8352
Electrolux Canada Corp.
5855 Terry Fox Way
Hississauga, Ontario, Canada
LSV 3E4

Specifications

Frigidaire FPES3085KFE Questions and Answers

Questions and Answers

Related Products