
Write the model and serial
numbers here:
Model # _________________
Serial # _________________
You can find the rating label
on the front behind the range
storage drawer on GE Appliances
models and under the cooktop
for Hotpoint models.
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
OWNER’S MANUAL
RANGES
Compact Electric
49-2001026 Rev. 2 05-22 GEA
SAFETY INFORMATION .......... 3
USING THE RANGE
Surface Units ........................... 8
Oven Controls ..........................12
Sabbath Mode ..........................12
Oven Racks ............................13
Aluminum Foil and Oven Liners ...........13
Cookware Guidelines ....................14
Cooking Modes .........................14
Cooking Guide .........................15
CARE AND CLEANING
Cleaning the Range – Exterior ............16
Oven ..................................18
Cleaning the Glass Cooktop ..............19
Door and Drawer .......................21
Oven Light .............................21
Oven Door ............................ 22
TROUBLESHOOTING TIPS ....... 23
LIMITED WARRANTY ............ 26
ACCESSORIES .................... 27
CONSUMER SUPPORT ........... 28
Hotpoint Models
RAS200
RAS240
RAS300
GE Model
JAS640
GE is a trademark of the General Electric Company. Manufactured under trademark license.

2 49-2001026 Rev. 2
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.

49-2001026 Rev. 2 3
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
WARNING
Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
WARNING
GENERAL SAFETY INSTRUCTIONS
■ Usethisapplianceonlyforitsintendedpurposeas
described in this Owner’s Manual.
■ FIRE HAZARD: Never leave the range unattended
with the cooktop ON above a Lo setting. Keep
flammable items away from the cooktop. Turn off all
controls when done cooking. Failure to follow these
instructions can result in fire, serious injury or death.
■ Besureyourapplianceisproperlyinstalledand
grounded by a qualified installer in accordance with
the provided installation instructions.
■ Donotattempttorepairorreplaceanypartofyour
range unless it is specifically recommended in this
manual. All other servicing should be transferred to
a qualified technician.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Donotleavechildrenalone—childrenshouldnot
be left alone or unattended in an area where an
appliance is in use. They should never be allowed
to climb, sit or stand on any part of the appliance.
■
CAUTION
Donotstoreitemsofinterestto
children above a range or on the backguard of a
range—childrenclimbingontherangetoreach
items could be seriously injured.
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam.Donotletpotholderstouchhotsurface
unitsorheatingelements.Donotuseatowelor
other bulky cloth in place of pot holders.
■ Neveruseyourapplianceforwarmingorheating
the room.
ANTI-TIP DEVICE
To reduce the risk of tipping the range, the range
must be secured by a properly installed anti-tip
bracket. See installation instructions shipped
with the bracket for complete details before
attempting to install.
For Free-Standing Ranges
To check if the bracket is installed, ensure
there is no cookware on top of the range and all
surfaces are cool to the touch. Carefully slide
out the range from the wall approximately three
inches. Look behind the range to see if there is
a metal bracket attached to the floor or the wall. To check if the bracket is installed correctly, grasp the back of
the range, being careful not to grab or bend the rear trim piece. Tilt the range forward
slightly and confirm the anti-tip bracket engages the back of the range, limiting the
forward tip of the range. If the anti-tip bracket does not engage the range and prevent
it from tipping, verify the anti-tip bracket has been properly installed. If this does not
solvetheproblemortheanti-tipbracketisnotpresent,call800.626.8774intheUSor
800.561.3344 in Canada.
If the range is pulled from the wall for any reason, always repeat this procedure to verify
the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured to the anti-tip
device properly.
Anti-Tip
Bracket
Free-Standing Ranges
• A child or adult can tip the range and be killed.
• Verify the anti-tip bracket has been properly
installed and engaged.
• Ensure the anti-tip bracket is re-engaged when
the range is moved.
• Do not operate the range without the anti-tip bracket
in place and engaged.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING

4 49-2001026 Rev. 2
WARNING
KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
■ Cleanventilatinghoodsfrequently.Greaseshould
not be allowed to accumulate on the hood or filter.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
WARNING
IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickup
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
tray.Useamulti-purposedrychemicalorfoam-type
fire extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheovenduringself-clean,turn
the oven off and wait for the fire to go out. Donot
force the door open. Introduction of fresh air at self-
clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING
GENERAL SAFETY INSTRUCTIONS (Cont.)
■ Donottouchthesurfaceunits,theheatingelements
or the interior surface of the oven. These surfaces
may be hot enough to burn even though they are
darkincolor.Duringandafteruse,donottouch,
or let clothing or other flammable materials contact
the surface units, areas nearby the surface units or
any interior area of the oven; allow sufficient time
for cooling first. Other surfaces of the appliance
may become hot enough to cause burns. Potentially
hot surfaces include the cooktop, areas facing the
cooktop, oven vent opening, surfaces near the
opening and crevices around the oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.
■ Donotuseanytypeoffoilorlinertocoverthe
oven bottom or anywhere in the oven, except as
described in this manual. Oven liners can trap heat
or melt, resulting in damage to the product and risk
of shock, smoke or fire.
■ Avoidscratchingorimpactingglassdoors,cook
topsorcontrolpanels.Doingsomayleadtoglass
breakage.Donotcookonaproductwithbroken
glass. Shock, fire or cuts may occur.
■ Cookfoodthoroughlytohelpprotectagainst
foodborne illness. Minimum safe food temperature
recommendations can be found at
IsItDoneYet.gov and fsis.usda.gov.
Useafoodthermometertotakefoodtemperatures
and check several locations.

49-2001026 Rev. 2 5
WARNING
COOKTOP SAFETY INSTRUCTIONS
■ Neverleavethesurfaceunitsunattendedwiththe
cooktopONaboveaLosetting.Boiloverscause
smoking and greasy spillovers that may catch on fire.
■ Alwaysbepresentattherangewhencookingwith
oil or grease. Surface cooking is an "attended"
activity.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets.Useadeepfatthermometerwhenever
possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,useaminimum
amount of oil when shallow pan-frying and avoid
cooking frozen foods with excessive amounts of ice.
■ Useproperpansize—selectcookwarehaving
flat bottoms large enough to cover the surface
heating element. The use of undersized cookware
will expose a portion of the surface unit to direct
contact and may result in ignition of clothing. Proper
relationship of cookware to surface unit will also
improve efficiency.
■ Onlycertaintypesofglass,glass/ceramic,
earthenware or other glazed containers are suitable
for cooktop service; others may break because of
the sudden change in temperature.
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby surface units.
■ Whenpreparingflamingfoodsunderahood,turn
the fan on.
■ Ifpowerislosttoanelectriccooktopwhilea
surface unit is ON, the surface unit will turn back on
as soon as power is restored. In the event of power
loss, failure to turn all surface unit knobs to the OFF
position may result in ignition of items on or near
the cooktop, leading to serious injury or death.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING
COIL COOKTOP SAFETY INSTRUCTIONS
■ Donotimmerseorsoaktheremovablesurface
units.Donotputtheminadishwasher.Donotself-
cleanthesurfaceunitsinanoven.Doingsomay
cause them to fail presenting a burn or fire hazard.
■Donotuseasurfaceunit(heatingelement)ifit
develops a glowing spot during use or shows
other signs of damage. A glowing spot indicates
the surface unit may fail and present a potential
burn, fire, or shock hazard. Turn the surface unit
off immediately and have it replaced by a qualified
service technician.
■Toavoidthepossibilityofaburnorelectricshock,
always be certain that the controls for all surface
units are at the OFF position and all coils are cool
before attempting to lift or remove a coil surface unit.
■Donotusealuminumfoiltolinedrippans.Foilcan
trap heat or melt, resulting in damage to the product
and a shock or fire hazard.
■Besurethedrippansarenotcoveredandarein
place. Their absence during cooking could damage
range parts and wiring.

6 49-2001026 Rev. 2
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING
RADIANT COOKTOP SAFETY INSTRUCTIONS
■ Usecarewhentouchingthecooktop.Theglass
surface of the cooktop will retain heat after the
controls have been turned off.
■ Donotcookonabrokencooktop.Ifglasscooktop
should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
■ Avoidscratchingtheglasscooktop.Thecooktop
can be scratched with items such as knives, sharp
instruments, rings or other jewelry, and rivets on
clothing.
■ Donotplaceorstoreitemsthatcanmeltorcatch
fire on the glass cooktop, even when it is not being
used. If the cooktop is inadvertently turned on, they
may ignite. Heat from the cooktop or oven vent after
it is turned off may cause them to ignite also.
■ Useceramiccooktopcleanerandanon-scratch
cleaning pad to clean the cooktop. Wait until the
cooktop cools and the indicator light goes out
before cleaning. A wet sponge or cloth on a hot
surface can cause steam burns. Some cleaners can
produce noxious fumes if applied to a hot surface.
NOTE: Sugar spills are an exception. They should
be scraped off while still hot using an oven mitt
and a scraper. See the Cleaning the glass cooktop
section for detailed instructions.
■ Readandfollowallinstructionsandwarningsonthe
cleaning cream label.
WARNING
OVEN SAFETY INSTRUCTIONS
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burnstohands,faceand/oreyes.
■ Donotusetheovenifaheatingelementdevelops
a glowing spot during use or shows other signs
of damage. A glowing spot indicates the heating
element may fail and present a potential burn, fire,
or shock hazard. Turn the oven off immediately and
have the heating element replaced by a qualified
service technician.
■ Keeptheovenventunobstructed.
■ Keeptheovenfreefromgreasebuildup.Greasein
the oven may ignite.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
■ Whenusingcookingorroastingbagsintheoven,
follow the manufacturer’s directions.
■ Pulltheovenracktothestop-lockpositionwhen
loading and unloading food from the oven. This
helps prevent burns from touching hot surfaces of
the door and oven walls.
■ Donotleaveitemssuchaspaper,cookingutensils
or food in the oven when not in use. Items stored in
an oven can ignite.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.

49-2001026 Rev. 2 7
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface.Donotuseanysharpitemstoremovethefilm.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
Consider recycling options for your appliance packaging
material.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
PROPER DISPOSAL OF YOUR APPLIANCE
DisposeoforrecycleyourapplianceinaccordancewithFederalandLocalRegulations.Contactyourlocal
authorities for the environmentally safe disposal or recycling of your appliance.

8 49-2001026 Rev. 2
USING THE RANGE:SurfaceUnits
Throughout this manual, features and appearance may vary from your model.
How to Set
Push the knob in and turn in either direction to the
setting you want.
A surface ON indicator light will glow when any surface
unit is on
For glass cooktop surfaces:
A HOT COOKTOP indicator light will:
■ comeonwhentheunitishottothetouch.
■ stayonevenaftertheunitisturnedoff.
■ stayonuntiltheunitiscooledto
approximately 150°F.
Surface Units
WARNING
FIRE HAZARD: Never leave the range unattended with the cooktop ON above a Lo setting. Keep
flammable items away from the cooktop. Turn off all controls when done cooking. Failure to follow
these instructions can result in fire, serious injury or death.
At both OFF and HI the control clicks into position. You may hear
slight clicking sounds during cooking, indicating the control is
maintaining your desired setting.
BesureyouturnthecontrolknobtoOFF when you finish cooking.
Coil Cooktops
Each coil surface unit uses "SENSI-TEMP
TECHNOLOGY" to reduce the risk of cooktop oil and
grease fires. This feature is located in the center of each
surface unit. Power to the surface unit is temporarily
interrupted when a pot or pan exceeds expected cooking
temperatures. Even after the surface units are turned off,
the surface unit retains enough heat to continue cooking.
To avoid overcooking, remove pans from the surface
units when the food is cooked. Avoid placing anything on
the surface unit until it has cooled completely.
Cookware for Coil Cooktops
The following information will help you choose cookware which will give good performance on coil cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the coil cooktop.
Recommended
Stainless Steel
Thin unclad stainless steel will give poor performance.
Aluminum
Heavy weight recommended.
Goodconductivity.Becauseofitslowmeltingpoint,thin
weight aluminum should not be used.
Copper Bottom
Enamel (painted) on Cast Iron
Cast Iron
Avoid/Not Recommended
Enamel (painted) on Steel
Glass-ceramic
Poor performance.
Stoneware
Poor performance.

49-2001026 Rev. 2 9
Temperature Limiter on Radiant Glass Cooktops
Every radiant surface unit has a temperature limiter.
The temperature limiter protects the glass cooktop from
getting too hot.
The temperature limiter may cycle the surface units off
for a time if:
■ thepanboilsdry.
■ thepanbottomisnotflat.
■ thepanisoff-center.
■ thereisnopanontheunit.
Radiant Glass Cooktop
The radiant cooktop features heating units beneath a
smooth glass surface.
NOTE: A slight odor is normal when a new cooktop is
used for the first time. It is caused by the heating of new
parts and insulating materials and will disappear in a
short time.
NOTE: On models with light-colored glass cooktops, it is
normal for the cooking zones to change color when hot
or cooling down. This is temporary and will disappear as
the glass cools to room temperature.
The surface unit will cycle on and off to maintain your
selected control setting.
It is safe to place hot cookware on the glass surface
even when the cooktop is cool.
Even after the surface units are turned off, the glass
cooktop retains enough heat to continue cooking. To
avoid overcooking, remove pans from the surface units
when the food is cooked. Avoid placing anything on the
surface unit until it has cooled completely.
■ Waterstains(mineraldeposits)areremovableusing
the cleaning cream or full-strength white vinegar.
■ Useofwindowcleanermayleaveaniridescentfilmon
the cooktop. The cleaning cream will remove this film.
■ Don’tstoreheavyitemsabovethecooktop.Ifthey
drop onto the cooktop, they can cause damage.
■ Donotusethesurfaceasacuttingboard.
USING THE RANGE:SurfaceUnits
Surface Units (Cont.)
Never cook directly on the glass. Always
use cookware.
Always place the pan in the center of the
surface unit you are cooking on.
Donotslidecookwareacrossthecooktopbecause
itcanscratchtheglass—theglassisscratch-
resistant, not scratch proof.

10 49-2001026 Rev. 2
Surface Units (Cont.)
USING THE RANGE:SurfaceUnits
Cookware for Radiant Glass Cooktops
The following information will help you choose cookware which will give good performance on glass cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the ceramic cooktop.
Recommended
Stainless Steel
Aluminum
Heavy weight recommended.
Good conductivity. Aluminum residues sometimes
appear as scratches on the cooktop but can be removed
ifcleanedimmediately.Becauseofitslowmeltingpoint,
thin weight aluminum should not be used.
Copper Bottom
Copper may leave residues which can appear as
scratches. The residues can be removed, as long as
the cooktop is cleaned immediately. However, do not let
these pots boil dry. Overheated metal can bond to glass
cooktops. An overheated copper bottom pot will leave
a residue that will permanently stain the cooktop if not
removed immediately.
Enamel (painted) on Cast Iron
Recommended if bottom of pan is coated.
Avoid/Not Recommended
Enamel (painted) on Steel
Heating empty pans can cause permanent damage to
cooktop glass. The enamel can melt and bond to the
ceramic cooktop.
Glass-ceramic
Poor performance. Will scratch the surface.
Stoneware
Poor performance. May scratch the surface.
Cast Iron
Notrecommended—unlessdesignedspecificallyfor
glass cooktops.
Poor conductivity and slow to absorb heat. Will scratch
the cooktop surface.

49-2001026 Rev. 2 11
More about Cookware
■ Placeonlydrypansonthesurfaceelements.Donot
place lids on the surface elements, particularly wet
lids. Wet pans and lids may stick to smooth surface
when cool.
■ Donotusewoksthathavesupportrings.Thistypeof
wok will not heat on the cooktop.
■ Werecommendthatyouuseonlyaflat-bottomed
wok. They are available at your local retail store. The
bottom of the wok should have the same diameter as
the surface element to ensure proper contact.
■ Somespecialcookingproceduresrequirespecific
cookware such as pressure cookers or deep-fat
fryers. All cookware must have flat bottoms and be
the correct size.
Home Canning Tips
Besurethecanneriscenteredoverthesurfaceunit.
Make sure the canner is flat on the bottom.
To prevent burns from steam or heat, use caution when
canning.
Userecipesandproceduresfromreputablesources.
TheseareavailablefrommanufacturerssuchasBall
®
and Kerr
®
andtheDepartmentofAgricultureExtension
Service.
Flat-bottomedcannersarerecommended.Useofwater
bath canners with rippled bottoms may extend the time
required to bring the water to a boil.
Check pans for flat bottoms by
using a straight edge. You should
notbeabletopassaUSnickelcoin
under the straight edge.
Pans with rounded, curved,
ridged or warped bottoms are not
recommended.
Donotplacewetpanson
the glass cooktop.
Donotusewokswithsupport
rings on the glass cooktop.
Useflat-bottomedwoks
on the glass cooktop.
USING THE RANGE:SurfaceUnits
Surface Units (Cont.)

12 49-2001026 Rev. 2
Oven Controls
To Adjust the Thermostat
1. Pull the Oven Temp knob off the range and look
at the back side. To make an adjustment, loosen
(approximatelyoneturn),butdonotcompletely
remove, the two screws on the back of the knob.
2. With the back of the knob facing you, hold the outer
edge of the knob with one hand and with the other
hand rotate the skirt.
Rotate the skirt clockwise to increase and
counterclockwise to decrease the oven temperature.
You’ll hear a click for each notch you move the knob.
Each click will change the oven temperature
approximately10°F.(Rangeisplusorminus
30°Ffromthearrow.)Wesuggestthatyoumake
the adjustment one click from the original setting
and check oven performance before making any
additional adjustments.
3. After the adjustment is made, retighten screws so
they are snug, but be careful not to overtighten.
4. Replace the knob, matching the flat area of the knob
to the shaft, and check performance.
Donotusethermometers,suchasthosefoundin
grocery stores, to check the temperature setting of your
oven. These thermometers may vary 20-40 degrees.
Oven Temperature Knob
Turn the OVEN TEMP knob to the setting you want.
TheOven/Cyclelightcomesonwhentheburnerison.It
will cycle on and off during cooking.
Front of OVEN TEMP knob
(knobappearancemayvary)
Certain models comply with Jewish Sabbath requirements for use during the Sabbath and holidays.
Start Baking
To start baking, simply turn the thermostat knob to the
desiredtemperature.Becauseathermostatmodelwill
respond with a clicking sound when the thermostat knob
is used to turn on the oven, this operation should take
place before the Sabbath or Holidays begin.
Adjusting the Temperature
To adjust the oven temperature while in compliance with
Sabbath requirements, the user must observe the oven
ON indicator light:
■Toadjusttheoventemperaturetoahighervalue,
the user must first confirm the "OVEN ON" light is
on. Only then, can the user turn the knob to a higher
temperature than was previously set.
■
To adjust the oven temperature to a lower value, the user
must first confirm the "OVEN ON" light is off. Only then,
can the user turn the knob to a lower temperature than
was previously set.
Stop Baking
To stop baking, simply turn the thermostat knob to the off
position.Becauseathermostatmodelwillrespondwitha
clicking sound when the thermostat knob is used to turn
off the oven, this operation should take place after the
Sabbath or Holidays end.
Oven Light Operation (on some models)
The oven light can be set to either on or off prior to the
start of the Sabbath or the holiday. Opening and closing
of the door will not change the state of the oven light.
Sabbath Mode Power Outage Note
If a power outage occurs during a Sabbath bake, the unit
will return to Sabbath bake mode when power is restored
and the oven will return to the same temperature as
before the outage, without any intervention from the user.
USING THE OVEN:OvenControls/SabbathMode
Sabbath Mode
BackofOVENTEMPknob
Clockwise to Increase
Temperature
(Shownathighestsetting)
Counterclockwise to
DecreaseTemperature
(Shownatlowestsetting)
Skirt(OutsideRing)

49-2001026 Rev. 2 13
USING THE RANGE:OvenRacks/AluminumFoilandOvenLiners
CAUTION
Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foilmaybeusedtocatchspillsbyplacingasheetonalowerrack,severalinchesbelowthefood.Donotusemore
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Aluminum Foil and Oven Liners
Rack Positions
Your oven has four rack positions in the main oven.
Recommended rack positions for various types of
foods are provided in the Cooking Guide. Adjusting
the rack position is one way to impact cooking results.
For example, if you would prefer darker tops on cakes,
muffins or cookies, try moving food one rack position
higher. If you find foods are too brown on top, try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is sufficient space between pans to allow
air to flow. This may improve cooking evenness.
Removing and Replacing Flat Racks
When placing and removing cookware, pull the rack out
tothebump(stopposition)ontheracksupport.
To remove a rack, pull it toward you until it reaches the
stop position, tilt up the front of the rack and pull it out.
To replace a rack, place the curved end of the rack onto
the rack supports. Tilt up the front of the rack and push
the rack in until it stops. Then lay the rack flat and push
it in until it is all the way into the oven.
Racks may become difficult to slide, especially after a
self-clean cycle. To improve sliding conditions, use a soft
cloth or paper towel to rub vegetable oil on the left and
rightedgesoftheracksand/orracksupports.
NOTE: Remove unused racks when using the oven for
faster preheat, improved efficiency, and optimal cooking
performance.
Rack positions
Removing racks
Replacing racks
Rack stop
position
Oven Racks

14 49-2001026 Rev. 2
The material, finish, and size of cookware affect baking
performance.
Dark,coatedanddullpansabsorbheatmorereadily
than light, shiny pans. Pans that absorb heat more
readily can result in a browner, crisper and thicker crust.
If using dark and coated cookware check food earlier
than the minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25º F next time.
■ Shinypanscanproducemoreevenlycookedbaked
goods such as cakes and cookies.
■ Glassandceramicpansheatslowlybutretainheat
well. These types of pans work well for dishes such
as pies and custards.
■ Airinsulatedpansheatslowlyandcanreducebottom
browning.
■ Keepcookwarecleantopromoteevenheating.
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for recommendations for specific foods. Remember, your new oven may perform
differently than the oven it is replacing.
Bake
The bake mode is for baking and roasting. When
preparing baked goods such as cakes, cookies and
pastries, always preheat the oven first. To use this mode
turn the thermostat knob to the desired temperature.
Warm (on some models)
Warm mode is designed to keep hot foods hot. Cover
foods that need to remain moist and do not cover foods
thatshouldbecrisp.Preheatingisnotrequired.Donot
use Warm to heat cold food. It is recommended that food
not be kept warm for more than 2 hours. To use this
mode turn the thermostat knob to Warm.
Broil
Always broil with the oven door and drawer closed.
Monitorfoodcloselywhilebroiling.Usecautionwhen
broiling on the upper rack positions as placing food
closer to the broil burner increases smoking, splattering,
and the possibility of fats igniting.
Try broiling foods that you would normally grill. Adjust
rack positions to adjust the intensity of the heat to the
food. Place foods closer to the broil burner when a
seared surface and rare interior is desired. Thicker foods
and foods that need to be cooked through should be
broiled on a lower rack position. To use this mode turn
the thermostat knob to the Broil setting.
Pre-Heat
Proper preheating ensures that the oven is hot enough
tobeginbaking.Improperpreheating(thatis,cooking
intheoventhathasnotcomeuptosettemperature)
cannegativelyaffectcooking.Dependingontherecipe
recommendations, the temperature of your foods when
they go into the oven may determine your final baking
time and baking results; if you put your food, such as
biscuits or breads, in during Pre-heat, they may over
brown on top or burn.
IMPORTANT: The more items to be heated in the oven
duringpreheat(thisincludesmultipleracks,baking
stones,etc.)willaffectthelengthofyourpre-heattime.
Always begin baking after the pre-heat signal. The signal
will be a beep, indicaotr light or chime. This lets you
know your oven is at your needed baking temperature.
For best results, turn the oven On before you begin your
prep work.
Cookware Guidelines
Cooking Modes
USING THE OVEN: CookwareGuidelines/CookingModes
Oven Cavity

49-2001026 Rev. 2 15
Cooking Guide
USING THE OVEN: Cooking Guide
FOOD TYPE
RECOMMENDED
MODE(S)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer Cakes, sheet cakes, bundt
cakes, muffins, quick breads on
a Single Rack
Bake 2 Useshinycookware.
Layer cakes* on Multiple Racks Bake 1 and 3
Ensure adequate airflow
(seeillustrationbelow).
Chiffoncakes(angelfood) Bake 1 Useshinycookware.
Cookies, biscuits, scones on a
Single Rack
Bake 3 Useshinycookware.
Cookies, biscuits, scones on
Multiple Racks
Bake 2 and 4 Ensure adequate airflow.
Beef & Pork
Hamburgers Broil 4
Useabroilpan;movefooddownformore
doneness/lesssearing.Watchfoodcloselywhen
broiling. For best performance center food below the
broil heating element.
Steaks & Chops Broil 4
Useabroilpan;movefooddownformore
doneness/lesssearing.Watchfoodcloselywhen
broiling. For best performance center food below the
broil heating element.
Roasts Bake 1 or 2
Usealowsidedpansuchasabroilpan.Preheating
is not necessary.
Poultry
Whole chicken Bake 2 Usealowsidedpansuchasabroilpan.
Bone-inchickenbreasts,legs,
thighs
Broil
Bake
1 or 2
IfbreadedorcoatedinsauceavoidBroilHimodes.
Broilskinsidedownfirst.Watchfoodcloselywhen
broiling. For best performance when broiling, center
food below the broil heating element.
Bonelesschickenbreasts
Broil
Bake
1 or 2
IfbreadedorcoatedinsauceavoidBroilHimodes.
Broilskinsidedownfirst.Watchfoodcloselywhen
broiling. For best performance when broiling, center
food below the broil heating element
Whole turkey Bake 1 or 2 Usealowsidedpansuchasabroilpan.
TurkeyBreast Bake 1 or 2 Usealowsidedpansuchasabroilpan.
Fish Broil 4
Watch food closely when broiling. For best
performance center food below the broil heating
element.
Casseroles Bake 2 or 3
Frozen Convenience Foods
Pizza, french fries, tator tots,
chicken nuggets, appetizers on a
Single Rack
Bake 3 Useshinycookware.
*When baking four cake layers at a time, stagger the pans
as shown so that one pan is not directly above another.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov. Make sure to use a food thermometer
to take food temperatures.
Rack position for baking 4 layer cakes.

16 49-2001026 Rev. 2
Cleaning the Range – Exterior
CARE AND CLEANING: Cleaning the Range – Exterior
A child or adult can tip the range and be killed.
Verify the anti-tip bracket has been properly installed
and engaged.
Ensure the anti-tip bracket is re-engaged when the range
is moved.
Do not operate the range without the anti-tip bracket in
place and engaged.
Failure to follow these instructions can result in death or
serious burns to children or adults.
Tip-Over Hazard
WARNING
WARNING
If your range is removed for cleaning, servicing or any reason, be sure the anti-
tip device is reengaged properly when the range is replaced. Failure to take this
precaution could result in tipping of the range and can result in death or serious
burns to children or adults.
Besureallcontrolsareoffandallsurfacesarecoolbeforecleaninganypartoftherange.
Control Knobs
The control knobs may be removed for easier cleaning.
Make sure the knobs are in the OFF positions and pull
them straight off the stems for cleaning.
The knobs can be cleaned in a dishwasher or they may
also be washed with soap and water. Make sure the
inside of the knobs are dry before replacing.
Replace the knobs, in the OFF position to ensure proper
placement.
Control Panel
It’s a good idea to wipe the control panel after each use.
Clean with mild soap and water or vinegar and water,
rinse with clean water and polish dry with a soft cloth.
Donotuseabrasivecleansers,strongliquidcleansers,
plastic scouring pads or oven cleaners on the control
panel—theywilldamagethefinish.
Oven Exterior
Donotuseovencleaners,abrasivecleansers,strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the interior or exterior of the oven.
Clean with a mild soap and water or vinegar and water
solution. Rinse with clean water and dry with a soft cloth.
When cleaning surfaces, make sure that they are at
room temperature and not in direct sunlight.
If stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up immediately. Let hot surfaces
cool, then clean and rinse.
Painted Surfaces
Painted surfaces include the sides of the range and the
door, top of control panel and the drawer front. Clean
these with soap and water or a vinegar and water solution.
Donotusecommercialovencleaners,cleaningpowders,
steel wool or harsh abrasives on any painted surface.
Stainless Steel Surfaces (on some models)
Donotuseasteelwoolpad;itwillscratchthesurface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
CleanerswithoxalicacidsuchasBarKeepersFriend
Soft Cleanser™ will remove surface rust, tarnish and
smallblemishes.Useonlyaliquidcleanserfreeofgrit
and rub in the direction of the brush lines with a damp,
soft sponge.
To inquire about purchasing cleaning products
including stainless steel appliance cleaner or polish,
see the Accessories and Consumer Support sections
at the end of this manual.
For easier cleaning, the control knobs may be removed
by pulling them directly outwards once the knobs are in
theOFFposition.Donotpullknobsupordownorhang
objects on them. This can damage the gas valve shaft.
The knobs can be washed by hand with soap and water
or in a dishwasher.
To replace knobs after
cleaning, align the hole
on the knob backside
with the gas valve shaft
and push inward until
the knob is securely
fastened. All knobs are
interchangeable
Surface burner knob

49-2001026 Rev. 2 17
BesurethecontrolsareturnedtoOFFandthesurfaceunitsarecoolbeforeattemptingtoremovethem.
Surface Units
To clean the surface units, turn the control to the highest
setting for a minute. The coils will burn off any soil. To
clean the Sensi-Temp Technology Sensor cap, wipe
with a damp sponge or cloth. For cooked-on food spills,
remove the burner from the range and gently scrub the
capandsupportswithadampplasticscouringpad.Do
not use steel wool. Allow the burner to dry over night
before re-installing it.
To remove a surface unit:
To remove the drip pans for cleaning, the surface units
must be removed first.
1. Push the surface unit back toward the receptacle.
2. Lift the surface unit about 1 inch above the drip pan
and pull it out.
Donotliftthesurfaceunitmorethan1inch.Ifyoudo,it
may not lie flat on the drip pan when you plug it back in.
NOTE: Repeated lifting of the surface unit more than
1 inch above the drip pan can permanently damage the
receptacle.
To replace a surface unit:
1. Replace the drip pan into the recess in the cooktop.
Make sure the opening in the pan lines up with the
receptacle.
2. Insert the terminals of the surface unit through the
opening in the drip pan and into the receptacle.
3. Push the surface unit in and down so it rests evenly in
the cooktop.
Donotimmersethesurfaceunitsinliquidsofanykind.
Donotcleanthesurfaceunitsinadishwasher.
Donotbendthesurfaceunitplugterminals.
Donotattempttoclean,adjustorinanywayrepairthe
plug-in receptacle.
DonotpullontheSENSI-TEMPTECHNOLOGYsensor
cap.
Porcelain Enamel Cooktop
The porcelain enamel finish is sturdy but breakable if
misused. This finish is acid-resistant. However, any
acidicfoodsspilled(suchasfruitjuices,tomatoor
vinegar)shouldnotbepermittedtoremainonthefinish.
If acids spill on the cooktop while it is hot, use a dry paper
towel or cloth to wipe it up right away. When the surface
has cooled, wash with soap and water. Rinse well.
For other spills such as fat spatterings, wash with soap
and water or cleansing powders after the surface has
cooled. Rinse well. Polish with a dry cloth.
Cleaning the Range – Exterior (Cont.)
CARE AND CLEANING: Cleaning The Oven - Exterior
SurfaceUnit
DripPan
Locking Tab
Cooktop Rim
SurfaceUnit
Locking
Tab
DripPan
Receptacle
Locking Tab
When properly seated, the locking tab should lock onto
the cooktop rim through the notch in the drip pan.

18 49-2001026 Rev. 2
Cleaning the Range – Exterior (Cont.)
CARE AND CLEANING:CleaningtheRange–Exterior/Oven
Drip Pans
Remove the surface units. Then lift out the drip pans.
For best results, clean the drip pans by hand. Place
theminacoveredcontainer(oraplasticbag)with
1
⁄4 cup
ammonia to loosen the soil. Rinse with clean water and
polish with a clean soft cloth.
The drip pans may also be cleaned in a dishwasher.
Cleantheareaunderthedrippansoften.Built-upsoil,
especially grease, may catch fire.
Donotcoverthedrippanswithfoil.Usingfoilsoclose
to the receptacle could cause shock, fire or damage to
the range.
NOTE: If your cooktop is equipped with shiny, silver-
colored drip pans, do not clean them in the self-cleaning
oven. Permanent damage to the finish can occur.
If your cooktop is equipped with black or gray porcelain-
coated drip pans, they can be cleaned in the oven during
theself-cleaningcycle.Beforeyoubeginaself-cleaning
cycle, remove any heavy soil from the drip pans and
placethemontheporcelain-coatedovenracks.Donot
place the drip pans directly on the oven bottom. After
the self-cleaning cycle is completed and the drip pans
are cool, wipe them with a damp cloth to remove any
remaining ash or residue.
Besureallcontrolsareoffandallsurfacesarecoolbeforecleaninganypartoftheoven.
Oven Interior
The interior of your new oven can be cleaned manually
or by using steam clean process.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up as soon as hot surfaces cool,
then clean and rinse.
Manual Cleaning
Donotuseovencleaners,strongliquidcleansers,steel
wool, or scouring pads on the interior of the oven. For
soils on the oven bottom and other enameled surfaces,
use a gentle abrasive containing oxalic acid, such as
BarKeepersFriend
®
, with a non-scratch sponge. Take
care not to apply any abrasive cleaners or sponges to
the door glass, as it will scratch the reflective coating.
The oven interior and door glass may be cleaned using
a soft cloth with a mild soap and water, or vinegar and
water solution. After cleaning, rinse with clean water and
dry with a soft cloth.
Steam Cleaning
Steam Cleaning is for cleaning light soil from your oven.
To use the Steam Clean feature:
1. Start with the oven at room temperature.
2. Wipe excess grease and soils from the oven.
3.Pour1/2cupofwaterontothebottomoftheoven.
4. Close the door.
5. Turn your oven temperature knob to 200ºF.
6.Setatimerfor21/2minutes.Whentimeisfinish,
turn oven temperature knob to Off.
7. Set a timer for 27 minutes to allow oven to cool down.
DonotopenthedoorduringtheSteamCleaning.Atthe
end of the cycle, soak up the remaining water, and wipe
the moisture-softened soil from the oven walls and door.
Oven Exterior
Donotuseovencleaners,abrasivecleansers,strong
liquid cleansers, steel wool, plastic scouring pads or
cleaning powders on the interior or exterior of the oven.
Cleanwithamildsoapandwaterora50/50solutionof
vinegar and water. Rinse with clean water and dry with a
soft cloth. When cleaning surfaces, make sure that they
are at room temperature and not in direct sunlight.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up as soon as hot surfaces cool,
then clean and rinse.
Oven Racks
All oven racks may be cleaned by hand with an abrasive
cleaner or steel wool.
After cleaning the racks, use a soft cloth or paper towel
to rub a small amount of vegetable oil on the left and
right edges of the rack. This will ensure the racks are
easy to slide in and out of the oven
Oven

49-2001026 Rev. 2 19
CARE AND CLEANING: Oven/CleaningtheGlassCooktop
Oven (Cont.)
Oven Heating Elements
Donotcleanthebakeelementorthebroilelement.Any
soil will burn off when the elements are heated.
To clean the oven floor, gently lift the bake element.
Clean the oven floor with warm, soapy water.
Gently lift the bake element
Cleaning the Glass Cooktop
Normal Daily Use Cleaning
To maintain and protect the surface of your glass cooktop,
follow these steps:
1. Beforeusingthecooktopforthefirsttime,cleanit
with a ceramic cooktop cleaner. This helps protect the
top and makes cleanup easier.
2. Regular use of ceramic cooktop cleaner will help keep
the cooktop looking new.
3. Shake the cleaning cream well. Apply a few drops of
ceramic cooktop cleaner directly to the cooktop.
4. Useapapertowelornon-scratchcleaningpadfor
ceramic cooktops to clean the entire cooktop surface.
5. Useadryclothorpapertoweltoremoveallcleaning
residue. No need to rinse..
NOTE:ItisveryimportantthatyouDONOTheatthe
cooktop until it has been cleaned thoroughly.
Burned-On Residue
NOTE:DAMAGEtoyourglasssurfacemayoccurifyou
use scrub pads other than those recommended.
1. Allow the cooktop to cool.
2. Spread a few drops of ceramic cooktop cleaner on
the entire burned residue area.
3. Usinganon-scratchcleaningpadforceramic
cooktops, rub the residue area, applying pressure as
needed.
4. If any residue remains, repeat the steps listed above
as needed.
5. For additional protection, after all residue has been
removed, polish the entire surface with ceramic
cooktop cleaner and a paper towel.
Useanon-scratchcleaningpadfor
ceramic cooktops
Clean your cooktop after each
spill.Useaceramiccooktop
cleaner.
For cleaning videos and
instructions, scan the QR code
with your device.
Ceramic
Cooktop
Cleaner

20 49-2001026 Rev. 2
CARE AND CLEANING: Cleaning the Glass Cooktop
Cleaning the Glass Cooktop (Cont.)
Metal Marks and Scratches
1. Becarefulnottoslidepotsandpansacrossyour
cooktop. It will leave metal markings on the cooktop
surface.
These marks are removable using the ceramic
cooktop cleaner with a non-scratch cleaning pad for
ceramic cooktops.
2. If pots with a thin overlay of aluminum or copper
are allowed to boil dry, the overlay may leave black
discoloration on the cooktop.
This should be removed immediately before heating
again or the discoloration may be permanent.
NOTE: Carefully check the bottom of pans for roughness
that would scratch the cooktop.
3. Becarefulnottoplacealuminumbakingsheetsor
aluminum frozen entrée containers on a hot cooktop
surface. It will leave shinny dots or markings on the
cooktop surface. These markings are permanent and
cannot be cleaned off.
Damage from Sugary Spills and Melted Plastic
Special care should be taken when removing hot substances to avoid permanent damage of the glass surface.
Sugaryspillovers(suchasjellies,fudge,candy,syrups)ormeltedplasticscancausepittingofthesurfaceofyour
cooktop(notcoveredbythewarranty)unlessthespillisremovedwhilestillhot.Specialcareshouldbetakenwhen
removing hot substances.
Besuretouseanew,sharprazorscraper.
Donotuseadullornickedblade.
1. Turn off all surface units. Remove hot pans.
2. Wearing an oven mitt:
a.Useasingle-edgerazorbladescrapertomove
the spill to a cool area on the cooktop.
b. Remove the spill with paper towels.
3. Any remaining spillover should be left until the surface
of the cooktop has cooled.
4. Don’tusethesurfaceunitsagainuntilallofthe
residue has been completely removed.
NOTE: If pitting or indentation in the glass surface has
already occurred, the cooktop glass will have to be
replaced. In this case, service will be necessary.
Cooktop Seal
To clean the cooktop seal around the edges of the glass,
lay a wet cloth on it for a few minutes, then wipe clean
with nonabrasive cleaners.
Heavy, Burned-On Residue
1. Allow the cooktop to cool.
2. Useasingle-edgerazorbladescraperatapproximately
a 45° angle against the glass surface and scrape the
soil. It will be necessary to apply pressure to the razor
scraper in order to remove the residue.
3. After scraping with the razor scraper, spread a few
drops of ceramic cooktop cleaner on the entire burned
residuearea.Useanon-scratchcleaningpadto
remove any remaining residue.
4. For additional protection, after all residue has been
removed, polish the entire surface with ceramic cooktop
cleaner and a paper towel.
The ceramic cooktop scraper and all recommended
supplies are available through our Parts Center. See the
Accessories and Consumer Support sections at the end
of this manual.
NOTE:Donotuseadullornickedblade.

49-2001026 Rev. 2 21
Cleaning the Oven Door
Cleaning the Door Interior
Donotallowexcesswatertorunintoanyholesorslots
in the door .
Wipe dish soap over any baked-on spatters on the glass.
Useasinglesidedsafetyrazorbladetocleanitoff.Then
wipe over the glass with a soapy cloth to remove any
residue and dry off.
The area outside the gasket can be cleaned with a soap-
filledplasticscouringpad.Donotruborcleanthedoor
gasket - it has an extremely low resistance to abrasion.
If you notice the gasket becoming worn, frayed or
damaged in any way or if it has become displaced on the
door, you should have it replaced.
Cleaning the Door Exterior
If a stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Donotusethismethodonanyothersurface.
Stainless Steel Surfaces (on some models)
Donotuseasteelwoolpad;itwillscratchthesurface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always
wipe the surface in the direction of the grain. Follow
the cleaner instructions for cleaning the stainless steel
surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
Door and Drawer
CARE AND CLEANING: DoorandDrawer/OvenLight
WARNING
SHOCK OR BURN HAZARD:Beforereplacingovenlightbulb,disconnecttheelectricalpowertothe
range at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn.
CAUTION
BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with
bare hands or a damp cloth can cause burns.
Oven Light
Removable Storage Drawer (on some models)
The storage drawer is a good place to store cookware
andbakeware.Donotstoreplasticsorflammable
material in the drawer.
The storage drawer may be removed for cleaning under
the range. Clean the storage drawer with a damp cloth or
sponge. Never use harsh abrasives or scouring pads.
Yourstoragedrawermayhaveplasticslides(shownto
theright)ormetalrails.Followtherespectiveremovaland
replacement instructions for your model’s configuration.
Removing the Storage Drawer:
1. Pull drawer straight out until it stops.
2. Continue to pull the drawer until it is detached from
the oven.
Replacing the Storage Drawer:
1. Rest the left drawer rail around the inner left rail guide
and slide it in slightly.
2. Place the right drawer rail around the inner right rail
guide and slide it in slightly.
2. Slide the drawer all the way in.
Oven Light Replacement
Besuretoletthelightcoverandbulbcoolcompletely.
To remove the cover:
1. Hold a hand under the cover so it doesn’t fall when
released. With fingers of the same hand, firmly push
back the wire cover holder. Lift off the cover.
Donotremoveanyscrewstoremovethecover.
2. Replace bulb with a 40-watt appliance bulb.
To replace the cover:
1. Place it into groove of the light receptacle. Pull wire
forward to the center of the cover until it snaps into place.
2. Connect electrical power to the range.
Wire cover holder

22 49-2001026 Rev. 2
Oven Door
Thedoorisveryheavy.Becarefulwhenremovingandliftingthedoor.Donotliftdoorbythehandle.
To Remove the Door:
1. Fully open the door.
2. Pull the hinge locks up and away from the range
frame to the unlocked position.
3. Firmly grasp both sides of the door near the top.
4. Close door until the top of the door is approximately
6”fromtherangeframe.
5. Lift door up and away from the range until both hinge
arms are clear of the slots in the range frame.
To Replace the Door:
1. Firmly grasp both sides of the door near the top.
2. With the door at the same angle as the removal
position, rest the notch on the underside of the left
hinge arm on the bottom edge of the left hinge slot.
The notch in the hinge arm must be fully seated into
the bottom of the slot. Repeat for the right side.
3. Fully open the door. If the door will not fully open, the
notches in the bottoms of the hinge arms have not
seated correctly in the bottom edge of the slot. Lift the
door off the range and repeat previous step.
4. Push the hinge locks toward the range cavity and
down to the locked position.
5. Close the oven door.
CARE AND CLEANING:OvenDoor
Removal position
Pull hinge locks up to unlock
Push hinge locks down to lockRest notch on bottom edge
of hinge slot
Notch
Bottom
edge of
slot
Hinge arm

49-2001026 Rev. 2 23
Problem Possible Cause What To Do
Surface units will not
maintain a rolling boil
or cooking is not fast
enough
Improper cookware being used. Usepanswhichareflatandmatchthediameterofthe
surface unit selected.
Insomeareas,thepower(voltage)maybe
low.
Cover pan with a lid until desired heat is obtained.
Coil surface units do
not work properly
The surface units are not plugged in
solidly.
With the controls off, check to make sure the surface
unit is plugged completely into the receptacle.
The surface unit controls improperly set. Check to see the correct control is set for the surface
unit you are using.
The drip pans are not set securely in the
cooktop.
With the controls off, check to make sure the drip pan is
in the recess in the cooktop and that the opening in the
pan lines up with the receptacle.
A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Sensi-Temp Technology sensor cap is
overly soiled.
Clean Sensi-temp Technology sensor cap per cleaning
the range section.
Sensi-temp sensor cap stuck or will not
flex up and down.
Call a qualified technician for replacement. Replace coil
surface units with only the exact replacement part.
Surface units do not
work properly
A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Cooktop controls improperly set. Check to see the correct control is set for the surface
unit you are using.
Surface unit stops
glowing when turned
to a lower setting
The unit is still on and hot. This is normal.
Scratches (may appear
as cracks) on cooktop
glass surface
Incorrect cleaning methods being used. Scratches are not removable. Tiny scratches will
become less visible in time as a result of cleaning.
Cookware with rough bottoms being used
orcoarseparticles(saltorsand)were
between the cookware and the surface
of the cooktop. Cookware has been slid
across the cooktop surface.
To avoid scratches, use the recommended cleaning
procedures. Make sure bottoms of cookware are clean
before use, and use cookware with smooth bottoms.
Areas of discoloration
on the cooktop
Food spillovers not cleaned before next use.
See the Cleaning the glass cooktop section.
Hot surface on a model with a light-colored
cooktop.
This is normal. The surface may appear discolored
when it is hot. This is temporary and will disappear as
the glass cools.
Plastic melted to the
surface
Hot cooktop came into contact with plastic
placed on the hot cooktop.
SeetheGlasssurface—potentialforpermanentdamage
section in the Cleaning the glass cooktop section.
Pitting (or indentation)
of the cooktop
Hot sugar mixture spilled on the cooktop. Call a qualified technician for replacement.
Frequent cycling off
and on of surface units
Improper cookware being used. Useonlyflatcookwaretominimizecycling.
My new oven doesn't
cook like my old one.
Is something wrong
with the temperature
settings?
Your new oven has a different cooking
system from your old oven and therefore
may cook differently than your old oven.
For the first few uses, follow your recipe times and
temperatures carefully. If you still think your new oven
is too hot or too cold, you can adjust the temperature
yourself to meet your specific cooking preference.
NOTE:ThisadjustmentaffectsBaketemperatures;it
willnotaffectBroil.
Troubleshooting Tips ... Beforeyoucallforservice
Save time and money! Review the charts on the following pages first and you may not need to call for service.
TROUBLESHOOTING TIPS

24 49-2001026 Rev. 2
Troubleshooting Tips ... Beforeyoucallforservice
Problem Possible Cause What To Do
Food does not bake
properly
Oven controls improperly set. See the Cooking Modes section.
Rack position is incorrect or rack is not level. See the Cooking Modes section and Cooking Guide.
Incorrect cookware or cookware of improper
size being used.
See the Cookware section.
Oven temperature needs adjustment. See the Oven Controls section.
Ingredient substitution Substituting ingredients can change the recipe
outcome.
Food does not broil
properly
Oven controls improperly set. Make sure you select the appropriate broil mode.
Improper rack position being used. See Cooking Guide for rack location suggestions.
Food being cooked in a hot pan. Make sure cookware is cool.
Cookware not suited for broiling. Useapanspecificallydesignedforbroiling.
Aluminum foil used on the broiling pan and
grid has not been fitted properly and slit as
recommended.
If using aluminum foil conform to pan slits.
Insomeareasthepower(voltage)maybelow. Preheat the broil element for 10 minutes.
Oven temperature
too hot or too cold
Oven temperature needs adjustment. See the Oven Controls section or adjust the
thermostat.
Oven does not work
or appears not to
work
A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Oven controls improperly set. SeetheUsingtheOvensection.
Oven is in Sabbath Mode. Verify, that the oven is not in Sabbath Mode. See the
Oven Controls section.
“Crackling” or
“popping” sound
This is the sound of the metal heating and
cooling during both the cooking and cleaning
functions.
This is normal.
Why is my range
making a "clicking"
noise when using
my oven?
Your range cycles the heating elements by
turning relays on and off to maintain the oven
temperature.
This is normal.
Storage drawer
won’t close
Power cord may be obstructing drawer in the
lower back of the range.
Reposition the drawer and power cord. See the
StorageDrawerRemovalinstructionsintheCareand
cleaning of the range section.
Rear drawer support is on top of the guide rail. Repositionthedrawer.SeeDoorandDrawerinthe
Care and Cleaning section.
Oven door is
crooked
The door is out of position. Becausetheovendoorisremovable,itsometimes
gets out of position during installation. To straighten
the door, push down on the high corner.
Oven light does not
work
Light bulb is loose or defective. Tighten or replace bulb.
Switch operating light is broken. Call for service.
Excessive smoking
during broiling
Food too close to burner element. Lower the rack position of the food.
Strong odor An odor from the insulation around the inside
of the oven is normal for the first few times the
oven is used.
This is temporary and will go away after several uses
or a self-clean cycle.
My oven door glass
appears to be
"tinted" or have a
"rainbow" color. Is
this defective?
No. The inner oven glass is coated with a heat
barrier to reflect the heat back into the oven to
prevent heat loss and keep the outer door cool
while baking.
Thisisnormal.Undercertainlightorangles,youmay
see this tint or rainbow color.
TROUBLESHOOTING TIPS

49-2001026 Rev. 2 25
TROUBLESHOOTING TIPS
Troubleshooting Tips ... Beforeyoucallforservice
Problem Possible Cause What To Do
Sometimes the oven
takes longer to preheat
to the same temperature
Cookware or food in oven. The cookware or food in the oven will cause the
oven to take longer to preheat. Remove items to
reduce preheat time.
Number of racks in oven. Adding more racks to the oven will cause the oven
to take longer to preheat. Remove some racks.
Oven racks are difficult
to slide
The shiny, silver-colored racks were cleaned
in a self-clean cycle.
Apply a small amount of vegetable oil to a paper
towel and wipe the edges of the oven racks with
thepapertowel.DonotspraywithPam
®
or other
lubricant sprays.
Drawer does not slide
smoothly or drags
The drawer is out of alignment. Fully extend the drawer and push it all the way in
SeeDoorandDrawerintheCareandCleaning
section.
Drawerisover-loadedorloadisunbalanced. Reduce weight. Redistribute drawer contents.
Steam from the vent When using the ovens, it is normal to see
steam coming out of the oven vents. As the
number of racks or amount of food being
cooked increases, the amount of visible
steam will increase.
This is normal.

26 49-2001026 Rev. 2
Staple your receipt here. Proof of the original purchase
date is needed to obtain service under the warranty.
GEAppliances.com
All warranty service is provided by our Factory Service Centers, or an authorized Customer Care
®
technician. To
schedule service online, visit us at GEAppliances.com/service_and_support/, or call GE Appliances at 800.GE.CARES
(800.432.2737).Pleasehaveyourserialnumberandyourmodelnumberavailablewhencallingforservice.
Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE Appliances factory
service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its
products by providing GE Appliances with information on your appliance. If you do not want your appliance data to be
sent to GE Appliances, please advise your technician not to submit the data to GE Appliances at the time of service.
What GE Appliances will not cover:
■ Service trips to your home to teach you how to use
the product.
■ Improperinstallation,deliveryormaintenance.
■ Failureoftheproductifitisabused,misused,
modified or used for other than the intended purpose
or used commercially.
■ Damagetotheglasscooktopcausedbyuseof
cleaners other than the recommended cleaning
creams and pads.
■ Damagetotheglasscooktopcausedbyhardenedspills
of sugary materials or melted plastic that are not cleaned
according to the directions in the Owner's Manual.
■ Replacementofhousefusesorresettingofcircuit
breakers.
■ Damagetotheproductcausedbyaccident,fire,
floods or acts of God.
■ Damagetofinish,suchassurfacerust,tarnish,orsmall
blemishes not reported within 48 hours of delivery.
■ Incidentalorconsequentialdamagecausedby
possible defects with this appliance.
■ Damagecausedafterdelivery.
■ Productnotaccessibletoproviderequiredservice.
■ Servicetorepairorreplacelightbulbs,exceptfor
LEDlamps.
■ ImmersingortamperingwiththeSensi-Temp
Technology coil surface units.
■ EffectiveJanuary1,2022,cosmeticdamagetothe
glass cooktop such as, but not limited to, chips,
scratches, or baked on residue not reported within 90
days of installation.
■ EffectiveJanuary1,2022,damagetotheglass
cooktop due to impact or misuse.
See example.
LIMITED WARRANTY
GE Appliances Electric Range Limited Warranty
EXCLUSION OF IMPLIED WARRANTIES
Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties,
including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or
the shortest period allowed by law.
This limited warranty is extended to the original purchaser and any succeeding owner for products purchased for
homeusewithintheUSA.IftheproductislocatedinanareawhereservicebyaGEAppliancesAuthorizedServicer
is not available, you may be responsible for a trip charge or you may be required to bring the product to an Authorized
GE Appliances Service location for service. In Alaska, the limited warranty excludes the cost of shipping or service
calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This limited warranty
gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your
legal rights are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: GE Appliances, a Haier company
Louisville, KY 40225
Extended Warranties: Purchase a GE Appliances extended warranty and learn about special discounts that are
available while your warranty is still in effect. You can purchase it online anytime at
GEAppliances.com/extended-warranty
or call 800.626.2224 during normal business hours. GE Appliances Service will still be there after your warranty expires.
For the period of GE Appliances will replace
One year
From the date
of the original
purchase
Any partoftherangewhichfailsduetoadefectinmaterialsorworkmanship.Duringthis
limited one-year warranty, GE Appliances will provide, free of charge, all labor and in-home
service to replace the defective part.

49-2001026 Rev. 2 27
Looking For Something More?
GE Appliances offers a variety of accessories to
improve your cooking and maintenance experiences!
Refer to the Consumer Support page for phone numbers
and website information.
The following products and more are available:
Accessories
SmallBroilerPan(8¾”x1¼”x13½”)
Parts
Oven racks
Oven burners
Light bulbs
Cleaning Supplies
CitruShine™ Stainless Steel Wipes
Stainless Steel Appliance Cleaner
Cleaning Pads for Ceramic Cooktops
Ceramic Cooktop Cleaner
Ceramic Cooktop Scraper
Kit(Kitincludescreamandcooktopscraper)
Graphite Lubricant
Accessories
ACCESSORIES

28 49-2001026 Rev. 2
Consumer Support
CONSUMER SUPPORT
GE Appliances Website
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day
of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support
servicesdesignedforyourconvenience.IntheUS:GEAppliances.com
Register Your Appliance
Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also mail in
thepre-printedregistrationcardincludedinthepackingmaterial.IntheUS:GEAppliances.com/register
Schedule Service
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
yourconvenienceanydayoftheyear.IntheUS:GEAppliances.com/service
or call 800.432.2737 during normal business hours.
Extended Warranties
Purchase a GE Appliances extended warranty and learn about special discounts that are available while your
warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your
warrantyexpires.IntheUS:GEAppliances.com/extended-warranty
or call 800.626.2224 during normal business hours.
Remote Connectivity
Forassistancewithwirelessnetworkconnectivity(formodelswithremoteenable),
visit our website at GEAppliances.com/connect orcall800.220.6899intheUS.
Parts and Accessories
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes
(VISA,MasterCardandDiscovercardsareaccepted).Orderon-linetoday24hourseveryday.
IntheUS:GEApplianceparts.com or by phone at 877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing
generally should be referred to qualified service personnel. Caution must be exercised, since improper
servicing may cause unsafe operation.
Contact Us
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the
details including your phone number, or write to:
IntheUS:GeneralManager,CustomerRelations|GEAppliances,AppliancePark|Louisville,KY40225
GEAppliances.com/contact
