
*DJJHQDX
en-us Operating instructions
fr-ca Notice d'utilisation
Dishwasher
DF250/DF251

2

3
en-us
Table of contents
en-us Operating instructions
(
Safety Definitions 6
(
IMPORTANT SAFETY INSTRUCTIONS 7
Risk of fire, electrical shock, or serious injury 7
GROUNDING INSTRUCTIONS 8
Safe Operation 8
Proper Care and Maintenance 9
ƒ
Causes of Damage 10
*
Getting Started 11
Appliance overview 11
Operating panel 12
Dishwasher interior components 12
Display indicators 12
Info button 12
Time setting 12
Switching on the appliance for the first time 13
Settings 13
Home Connect™ System 15
Setting up the app 15
Setting up Home Connect 15
WLAN | 15
Network login 15
Connect to App 15
Remote start button 16
Wi-Fi without a connection to the
Home Connect server 16
Remote diagnosis 16
+
Water softening system / special salt 16
Water hardness table 16
Adjusting the water softening system 17
Using special salt 17
Detergent with a salt component 18
Switching off water softening system 18
,
R i n s e A i d 1 8
Adding rinse aid 18
Setting the amount of rinse aid used 19
Switching off rinse aid refill indicator 19
Loading the Dishwasher 20
Dishware material 20
Glass and silverware damage 20
Loading the racks 21
Loading patterns 21
Unloading the dishwasher 23
Adjusting the height of the rack 23
RackMatic
®
System 23
Removing/Installing third rack 24
Removing/Installing upper rack with Rackmatic
®
25
Rack features 26
.
Detergent 28
Adding detergent 28
Combination detergent 29
/
Dishwasher Cycles 30
0
Dishwasher Cycle Options 31
Intensive Zone 31
Turbo ¥ 31
Extra Dry 31
Wash Cycle Information 31
1
Operating the Dishwasher 32
Protection against unintentional operation 32
Operating the touch buttons 32
Changing the settings 32
AquaSensor 33
Time display 33
Sensor setting 33
Extra Dry 33
Eco forecast 33
Auto power off 33
Tone volume 33
Button volume 33
Greeting 34
Factory setting 34
Switching the appliance on 34
Delay start time 34
InfoLight
® *
34
EmotionLight 35
Wash cycle end 35
Switching off the appliance 35
Interrupting the wash cycle 35
Cancel a cycle (reset) 35
Changing the wash cycle 35

4
en-us
2
Care and Maintenance 36
Cleaning the dishwasher 36
Special salt and rinse aid 36
Filters 36
Spray arms 38
Drain pump 38
Preparing your unit for vacation 39
Winterizing your unit 39
3
Troubleshooting 40
Error message 40
Fault table 40
4
Customer Service 47
‡
Statement of Limited Product Warranty 47
What this Warranty Covers & Who it Applies to: 47
How Long the Warranty Lasts 47
Repair/Replace as Your Exclusive Remedy 48
Out of Warranty Product 48
Warranty Exclusions 48
How to Obtain Warranty Service 49
5
Installation and connection 49
Parts included 49
Safety instructions 49
Delivery 50
Technical specifications 50
Installation 50
Drain connection 50
Water supply connection 51
Hot water connection 51
Electrical connection 52
Removing the appliance 52
Transporting the appliance 52
Securing the appliance against frost 52

5
en-us
&RQJUDWXODWLRQVDQG7KDQN<RXIURP*DJJHQDX
3KRQH
0DLQ6WUHHW6XLWH
,UYLQH&$
7KDQN\RXIRUVHOHFWLQJD*DJJHQDXGLVKZDVKHU<RXKDYHMRLQHGWKHPDQ\FRQVXPHUV
7KLVPDQXDOZDVZULWWHQZLWK\RXUVDIHW\DQGFRQYHQLHQFHLQPLQGDQGWKHLQIRUPDWLRQFRQWDLQHGKHUHLQLVYHU\LPSRUWDQW
7ROHDUQHYHQPRUHDERXW\RXUGLVKZDVKHUDQGDYDLODEOHDFFHVVRULHVDVZHOODVPDQ\RWKHUWRSTXDOLW\
3OHDVHFRQWDFWXVLI\RXKDYHDQ\TXHVWLRQVRUFRPPHQWV
ZKRGHPDQGTXLHWDQGVXSHULRUSHUIRUPDQFHIURPWKHLUGLVKZDVKHUV
:HKLJKO\UHFRPPHQGWKDW\RXUHDGWKLVPDQXDOEHIRUH\RXXVH\RXUGLVKZDVKHUIRUWKHILUVWWLPH
*DJJHQDXDSSOLDQFHVYLVLWRXUZHEVLWHDWZZZJDJJHQDXXVDFRP
*DJJHQDX
86$
LQIR#JDJJHQDXXVDFRP
ZZZJDJJHQDXXVDFRP

6
en-us Safety Definitions
(
Safety Definitions
Safety Definitions
WARNING
This indicates that death or serious injuries may
occur as a result of non-observance of this
warning.
CAUTION!
This indicates that minor or moderate injuries may
occur as a result of non-observance of this
warning.
NOTICE: This indicates that damage to the appliance
or property may occur as a result of non-compliance
with this advisory.
Note: This alerts you to important information and/or
tips.

7
IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
(
IMPORTANT SAFETY INSTRUCTIONS
This dishwasher is provided with Installation
Instructions and this Use and Care Manual.
Read and understand all instructions before
using the dishwasher.
This dishwasher is intended for use up to a
maximum altitude of 13,000 ft (4,000 meters)
above sea level.
To reduce the risk of fire, electrical shock,
or serious injury, observe the following:
Risk of fi re, el ect r i cal shock, or ser i ous injury
WARNING
Risk of injury or death!
Misuse of the dishwasher can result in
serious injury or death. Do not use the
dishwasher in any way not covered in this
manual or for any purpose other than
those explained in the following pages.
WARNING
Risk of injury!
Severe injury and/or product damage
could result from the use of unauthorized
service technicians or non-original
replacement parts. All repairs must be
performed by an authorized service
technician using only original equipment
factory replacement parts.
WARNING
Risk of electrical shock or fire!
Electrical shock or fire could result if the
electrical supply for the dishwasher
covered in this manual is incorrectly
installed or if the dishwasher has been
improperly grounded. Do not use the
dishwasher covered in this manual unless
you are certain the electrical supply has
been correctly installed and the
dishwasher has been properly grounded.
WARNING
Health hazard!
Never use harsh chemicals to clean your
dishwasher. Some bleach-based products
can damage your dishwasher and may
present health hazards!

IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
8
GROUNDING INSTRUCTIONS
This appliance must be grounded to a metal,
permanent wiring system or an equipment
grounding conductor must be run with the
circuit conductors and connected to the
equipment grounding terminal or lead on the
dishwasher. See the Installation Instructions
included with this dishwasher for more
information on electrical requirements.
WARNING
Risk of electric shock!
This appliance must be grounded. In the
event of a malfunction or breakdown,
grounding will reduce the risk of electric
shock by providing a path of least
resistance for electric current. This
appliance is equipped with a cord having
an equipment-grounding conductor.
Improper connection of the equipment-
grounding conductor can result in risk of
electric shock. Check with a qualified
electrician if you are in doubt whether the
appliance is properly grounded.
Safe Operation
Use this dishwasher only for its intended
function, which is the washing of household
dishware and kitchenware rated as dishwasher
safe.
Use only detergents or rinsing agents
recommended for use in a dishwasher, and
keep them out of the reach of children.
CAUTION!
When loading items to be washed:
ʋ Locate sharp items so they are not
likely to damage the door seal.
ʋ Load knives and other sharp utensils
with their HANDLES UP to reduce the
risk of cut-type injuries.
ʋ Do not wash plastic items unless they
are marked “dishwasher safe” or the
equivalent. For plastic items not so
marked, check the manufacturer’s
recommendations.
ʋ Do not operate your dishwasher unless
all enclosure panels are in place.
ʋ Do not tamper with or override
controls and interlocks.
Do not abuse, sit or stand on the door or dish
racks of the dishwasher.

9
IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
WARNING
Risk of injury!
To avoid risk of injury, always use caution
when opening the door during or
following a wash cycle as hot water or
steam may escape. Do not fully open the
door until water noises have stopped and
steam has subsided.
To reduce risk of injury, do not allow
children to play in or on the dishwasher.
When children become old enough to
operate the appliance, it is the
responsibility of the parents/legal
guardians to ensure the children are
instructed in safe practices by qualified
persons.
NSF/ANSI 184 Certified residential
dishwashers are not intended for licensed
food establishments.
Proper Care and Maintenance
WARNING
Risk of explosion!
Under certain conditions, hydrogen gas
may be produced in a hot water system
that has not been used for two weeks or
more. Hydrogen gas is explosive. Before
using a dishwasher that is connected to a
hot water system that has been unused
for two weeks or longer, turn on all hot
water faucets and let the water flow from
each for several minutes. This will release
any accumulated hydrogen gas. As the
gas is explosive, do not smoke or use an
open flame during this time.
Remove the dishwasher door to the washing
compartment when removing an old
dishwasher for service or discarding.
To avoid floor damage and possible mold
growth, do not allow wet areas to remain
around or under the dishwasher.
Note: To avoid dishwasher damage, do not
allow water to remain in your dishwasher
systems through extended periods of freezing
temperatures. Freezing temperatures can
damage the water fill valve and potentially
other components of your dishwasher.
NOTICE: It is highly recommended for the
end user to become familiar with the
procedure to shut off the incoming water
supply and the procedure to shut off the
incoming power supply. See the Installation
Instructions or contact your installer for more
information.
State of California Proposition 65 Warning:
WARNING
This product can expose you to chemicals
including vinyl chloride, which is known
to the State of California to cause cancer
and birth defects or other reproductive
harm. For more information go to
www.P65Warnings.ca.gov.

10
en-us Causes of Damage
ƒ
Causes of Damage
Causes of Damage
NOTICE: ʑNever use steam cleaning products to clean
your dishwasher. The manufacturer will not be liable
for the possible damages or consequences.
ʑ To avoid possible dishwasher damage, do not use
harsh chemicals, abrasive cleaners, scouring pads
(metal or plastic), or abrasive cloths/paper towels to
clean your dishwashers exterior door panel. Your
dishwasher's exterior door panel can be damaged by
doing so.
ʑ To avoid dishwasher damage, do not load the
dishwasher with paper products, plastic bags,
packing materials or anything other than normal,
dishwasher safe dishware and kitchenware.
ʑ Protect your dishwasher from the elements. Protect
against freezing to avoid possible damage to the fill
valve. Damage caused by freezing is not covered by the
warranty.

11
Getting Started en-us
*
Getting Started
Getting Start ed
Appliance overview
The dotted lines show optional features which may or
may not be included with your dishwasher.
67$57
UHVHWVHF
VHF
K
PLQ
UHVHWVHFVHFW

12
en-us Getting Started
The numbers stated below refer to the overview images
on the previous page of this manual.
Operating panel
** the wash cycles and options will vary by model
Dishwasher interior components
* optional feature which may or may not be included with
your dishwasher.
Display indicators
--------
Info button
Info but t on
The Info button can be used to display additional wash
cycle information.
1. Press the Info button 8.
2. Press the wash cycle button.
Information on the selected wash cycle is indicated
on the display window at the top @.
3. To leave, press Info button 8.
Time setting
Ti me set t i ng
When the appliance is switched on for the first time, the
time starts at 12:00 o’clock.
Set the time as follows:
1. Open the door.
2. Switch on ON/OFF switch (.
3. Press Info button 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with W 3 sec.
4. Keep pressing button > ` until the time setting is
indicated on the display window at the top @.
5. Make the setting with setting buttons + - X. If the
selection buttons + - X are held down, the set
values are changed in 10-minute increments.
6. Press and hold the Info button 8 for 3 seconds.
The selected setting has now been stored.
Note: If the appliance was disconnected from the power
supply for a prolonged period, the time starts at 12:00
o’clock. Set the time.
( On/Off button
0 Wash cycles**
8 Info button
@ Digital display
H Rinse aid refill indicator
P Salt refill indicator
X Selection buttons
` Delay start / < button
h Remote start / > buttton
)" Wash cycle options**
)* START button
1" Interior light *
1* Third rack
12 Upper rack
1: Upper spray arm
1B Detergent tab tray
1J Lower spray arm
1R Dispenser for special salt
1Z Filters
1b Silverware basket *
1j Lower rack
9" Rinse aid dispenser
9* Detergent dispenser
92 Lock for detergent dispenser
9: Rating plate
¯:¯¯ Cycle time remaining
% Lights up when rinse aid is low
$ Lights up when salt is low
| Lights up when wifi is connected

13
Getting Started en-us
Switching on the appliance for the first
time
When you first turn on the dishwasher, you are taken
directly to the settings for switching on the appliance for
the first time. The following text is indicated on the
display window at the top @:
Scroll with < >
Set with + -
Leave with W 3 sec.
The required settings for switching on the appliance for
the first time are listed in the table below.
Change the setting as follows:
1. Keep pressing button > ` until the required setting
is displayed.
2. Make the selection with setting buttons + - X.
3. Press and hold the Info button 8 for 3 seconds.
The selected setting has now been stored.
--------
Settings
The dishwasher has been preset with certain settings
for your convenience. You can change these factory
setting.
Change the setting as follows:
1. Open the door.
2. Switch on ON/OFF switch (.
3. Press Info button 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with W 3 sec.
4. Keep pressing button > ` until the required setting
is displayed.
5. Make the selection with setting buttons + - X.
6. Press and hold the Info button 8 for 3 seconds.
The chosen setting has now been stored.
You have the option of resetting all changed settings
back to the original factory settings.
Note: When you reset your dishwasher to the factory
settings, you are taken directly to the settings for
switching on the appliance for the first time.
Settings
Switching on the
appliance for the first
time
Factory setting Infotext
by pressing Info button
Language American English Language selection.
Time format 24h 12h or 24h.
Time setting 12:00 Set the current time.
Water soft setting °E 0 - 8 soft Setting water hardness. When using Multitabs, select the
lowest setting.
Rinse aid setting Level 5 Amount of rinse aid affects drying.
Setting Factory setting Infotext
by pressing Info button
Time setting 12:00 Set the current time.
Time format 24h 12h or 24h.
Time display Time Show end of wash cycle with display "Time" or "In hours".
Language American English Language selection.
Water hardness °E0-8 Soft Setting water hardness. When using Multitabs, select the
lowest setting.
Rinse aid disp. Level 5 Amount of rinse aid affects drying.
Sensor setting Standard Adjusting water clarity detection for best cleaning results.
Extra dry Off Improved drying for glasses and plasticware.
Eco forecast Off Show the water and energy consumption.

14
en-us Getting Started
Notes
ʑ The “Network login” menu option is only available if
WLAN has been switched on.
ʑ The “Connect to App” menu option is only available if
a connection to the home network has been
established.
--------
Auto Power Off Off Appliance automatically switches off at end of rinsing
process.
EmotionLight On Interior light.
Front display* On The front display can be selected.
Remaining time proj. * On While program is running, status information is projected
onto floor.
Infolight * On Light is projected to signal an active cleaning cycle.
Start Program Auto 130-150 °F When switching on, the last selected wash cycle appears.
Tone volume Level 2 Volume of signal at end of wash cycle.
Button volume Level 2 Volume when using buttons.
WLAN on/off Switch wireless network connection on or off.
Network login Manual or
Autom./ WPS
Check WPS function on router. WLAN must be turned on for
this setting to appear.
No WPS function: Manual
WPS function: Automatic
Connect to App Start with + Connect appliance to mobile terminal device. Appliance must
be connected to the network for this setting to appear.
Greeting On When switching on the appliance, the brand logo can be
deselected.
Factory setting Reset Resetting to the factory setting.
* depending on the features of your dishwasher
Setting Factory setting Infotext
by pressing Info button

15
Getting Started en-us
Home Connect™ System
This dishwasher is Wi-Fi capable and can be remotely
controlled via a mobile device.
If your dishwasher does not connect to the home
network, you can also operate the dishwasher manually
by pressing the buttons.
Refer to appliance overview for the location of the
buttons. a "Appliance overview" on page 11
Setting up the app
To be able to operate the appliance via Home Connect,
the Home Connect app must be installed on your mobile
device.
Observe the supplied Home Connect documents with
regard to this.
Follow the steps specified by the app to implement the
settings.
Setting up Home Connect
You can set your dishwasher by pressing the remote
start button h or proceed as follows:
1. Open the door.
2. Switch on the On/Off switch (.
3. Press Info button 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with Setup 3 sec.
4. Keep pressing button > h until the required setting
is indicated on the display window at the top @.
5. Make the setting with setting buttons + - X. See
table in section
6. Press and hold the Info button 8 for 3 seconds.
The chosen setting has now been stored.
WLAN |
In the WLAN menu you can activate the wireless
network connection with “on” and deactivate it with
“off”.
Notes
ʑ If you have selected the Wi-Fi “off” setting, the
“Network login” and “Connect to App” settings are
not available.
ʑ Remote control of the appliance requires a stable
wireless network connection.
Network login
In the “Network login” menu you can select between
“Automatic/WPS” and “Manual” to connect the
dishwasher to your home network. To do this, test the
WPS function on your router.
Refer to Home Connect leaflet for detailed instructions.
Automatic: Connect to the home network using the WPS
function of your router.
Manual: Connect your mobile device to the Home
Connect network. The network settings are then
manually entered using the Home Connect App to
connect to your home network.
Following successful connection, the following text is
indicated on the display window at the top @:
“Network login successful”.
Note: The “Network login” menu item is not available
unless you have activated WLAN.
Connect to App
The “Connect to App” menu option is not available
unless there was a connection to the home network.
The “Connect to App” setting establishes the link
between the dishwasher, App and your user account.
Following successful connection, the following text is
indicated on the display window at the top @:
“Connection to app successful”.
Refer to the Home Connect leaflet for further
information.

16
en-us Water softening system / special salt
Remote start button
Once the dishwasher is connected to the home network,
press the remote start button h to control the
dishwasher from your device.
If the dishwasher has still not logged into Home
Connect, access the Home Connect settings by
pressing the remote start button h.
Follow the directions in the supplied Home Connect
leaflet.
Note: Your dishwasher is protected against
unintentional operation. If the appliance door remains
open for more than 4 seconds after pressing the
Remote Start buttonh, the operation will be paused.
Press the Remote Start button h again and close the
appliance door to resume control. Also see section
Notes
ʑ When the login process is complete, the Remote
Start button h goes out.
ʑ To activate the remote control, press the Remote
Start button h.
ʑ If the Home Connect Assistant was aborted during
start-up, press the Remote Start button h again.
ʑ If the connection to the router fails, | flashes on the
display.
Wi-Fi without a connection to the Home
Connect server ƒ
Wi-Fi without a connect i on to the Home Connec t ser v er
You can use the Home Connect App to disconnect
from the Home Connect server.
The appliance is then locally connected to your mobile
device without any connection to the Home Connect
server.
Note: If you did not deactivate the connection to the
Home Connect server, check your Internet connection.
Remote diagnosis ~
Remot e di a gnos i s
Customer Service can use Remote Customer Service~
to access your appliance if you contact them.
Notes
ʑ You have to confirm Customer Service access on
your appliance.
ʑ You can switch off Remote Customer Service ~
using the On/Off switch ( or deactivate Customer
Service access in the Home Connect App.
+
Water softening system / special salt
Water softening system / special salt
To ensure good rinsing results, the dishwasher requires
soft water, i.e. water which is low in lime, otherwise
limescale will be deposited on the utensils and interior
container. Tap water above 7° dH (1.2 mmol/l) must be
softened. The water is softened with special salt
(regeneration salt) in the water softening system
of the dishwasher. The setting and therefore the
required amount of salt depends on the degree of
hardness of your tap water (see following water
hardness table).
Water hardness table
:DWHU
KDUGQHVV
YDOXH(
VRIW
PHGLXP
KDUG
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
PPROO
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
Ȣ
6HWYDOXH
RQWKH
PDFKLQH
+DUGQHVV
UDQJH
KDUG
KDUG
PHGLXP
PHGLXP
VRIW

17
Water softening system / special salt en-us
Adjusting the water softening system
The amount of salt dispensed can be set from 0 to 62°E.
Salt is not required at the set value 0-8.
Set the softening system as follows:
1. Ask your local water utility company for the water
hardness value of the tap water.
2. Required setting can be found in the water hardness
table.
3. Open the door.
4. Switch on ON/OFF switch (.
5. Press Info button 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with W 3 sec.
6. Keep pressing button > ` until the water hardness
is indicated on the display window at the top @.
7. Make the selection with setting buttons + - X.
8. Press and hold the Info button 8 for 3 seconds.
The chosen setting has now been stored.
Using special salt
As soon as the low salt indicator P lights up on the
digital display, salt should be topped off. Refilling the
salt dispenser should be done before switching on the
appliance. This ensures that extra salt water is washed
out and will not corrode the rinsing tank.
NOTICE: Detergent will destroy the water softening
system! Never pour detergent into the salt dispenser.
Top off the salt as follows:
1. Undo the screw plug on the dispenser 1R.
2. Fill the dispenser with water (required only when
switching on the appliance for the first time).
3. Add salt as illustrated (do not use table salt or tablets).
The water is displaced and runs out.
For more information about buying dishwasher salt,
please contact Customer Service 1-800-944-2904.

18
en-us Rinse Aid
Using detergents with salt component
Det er ge nt with a sal t component
If combined detergents with a salt component
are used, special salt can usually be omitted up
to a water hardness of 21° dH (37° fH, 26° Clarke,
3.7 mmol/l). If the water hardness is over 21° dH, salt
must be used.
Switching off low salt indicator / water
softening system
Switchi ng of f wat er sof t eni ng syst em
If the use of combined detergents with a salt
component impairs the low salt indicator P on the
control panel or the text on the display window at the
top @ (enough salt for x rinse cycles), the displays
can be switched off.
Proceed as described under “Setting water softening
system” and set the value to 0-8. The water softening
system and salt refill indicator are now switched off.
,
R i n s e A i d
Rinse Aid
As soon as the low rinse aid indicator H lights up on
the control panel, rinse aid should be topped off.
The rinse aid is required for stain-free utensils and clear
glasses. Use only rinse aid which the manufacturer
designates as safe to use in domestic dishwashers.
Combined detergents with rinse aid component may be
used with soft to moderately hard water only (0-2 bands
on test strip or up to an °E value of 20). For moderately
hard to hard water (3 to 4 bands on test strip or °E value
of 21 or higher), rinse aid must be used.
Adding rinse aid
NOTICE: To avoid oversudsing or clogging, do not
overfill the rinse aid dispenser 9". Wipe up any spills
with a damp cloth.
1. Open the rinse aid dispenser 9" by pressing on the
latch of the lid and pulling it open.
2. Add liquid rinse aid to the dispenser 9" until it is
full. Do not overfill. Avoid spilling into air vent hole.
PD[
WFOU
BJS

19
Rinse Aid en-us
3. Close the lid. Lid must be fully closed until it clicks in
order to seal.
4. Wipe up any excess rinse aid that may have puddled
when the dispenser reservoir is full.
This prevents excessive frothing during the next wash
cycle. The indicator light will go out a few moments
after the dishwasher door is shut.
Tip: For easier pouring, remove lid from the rinse aid
bottle.
NOTICE: Do not fill the rinse aid dispenser 9" with
detergent. Doing so will damage the dishwasher.
Setting the amount of rinse aid used
The amount of rinse aid to be dispensed can be set from
0 to 6. Set the amount of rinse aid to be dispensed to 5
to obtain a very good drying result. Do not change the
amount of rinse aid unless there are streaks or water
stains on the utensils. Set a lower level to avoid streaks.
Set a higher level to avoid water stains.
Set the amount of rinse aid as follows:
1. Open the door.
2. Press on ON/OFF button (.
3. Press Info button 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with W 3 sec.
4. Keep pressing button > ` until the rinse aid
dispenser is indicated on the display window at the
top @.
5. Make the selection with setting buttons + - X.
6. Press and hold the Info button 8 for 3 seconds.
The chosen setting has now been stored.
Note: Do not change the amount of rinse aid unless
there are streaks (select lower setting) or water stains
(select higher setting) visible on the utensils.
Switching off rinse aid refill
indicator
If the use of combined detergents with a rinse aid
component impairs the low rinse aid indicator H on
the control panel (enough rinse aid for x rinse cycles),
the displays can be switched off.
Proceed as described under “Setting amount of rinse
aid” and select setting 0.
NOTICE: Using no rinse aid or setting the dispenser
to 0 may result in longer cycle times consuming more
energy and water. The higher temperatures can damage
fine china or glassware.

20
en-us Rinse Aid
Loading the Dishwasher
Dishware material
Note: Before using your dishwasher for the first time,
check the information in this section. Some items are
not dishwasher-safe and should be hand washed; others
require special loading.
Glass and silverware damage
Causes:
ʑ Glass type.
ʑ Type of dishwasher detergent.
ʑ Water temperature of the wash cycle.
Recommendation:
ʑ Use only glasses and porcelain which
the manufacturer designates as dishwasher-safe.
ʑ Use a detergent which protects silverware.
ʑ Use less intensive wash cycles and take glass and
silverware out of the dishwasher as soon as possible
after the wash cycle ends.
Recommended Precaution
Aluminum Colored anodized aluminum may
fade over time. Minerals in your
water may cause the aluminum to
darken or spot. This can usually
be removed with a soap-filled
steel wool pad.
China, Crystal,
Stoneware
Some hand-painted utensils may
discolor, fade or spot. Hand wash
these utensils. Position fragile
glassware so that it will not topple
over or come in contact with other
utensils during the wash cycle.
Glass Make sure to use dishwasher-
safe glass. Milk glass may
discolor or become yellow.
Non-stick Coatings Apply a light coating of vegetable
oil to non-stick surfaces after
drying.
Plastics Make sure the plasticware is
dishwasher-safe.
Stainless Steel,
Sterling Silver and
Silver Plates
Load these so they do not come
in contact with other metals,
stainless steel dishwasher tank
walls or the inner door.
Not
Recommended
Reason
Acrylic Crazing or small cracks
throughout the acrylic, may occur.
Adhesive-
Joined Pieces
Adhesives that join materials such
as plastic, wood, bone, steel,
copper, tin, etc. may loosen.
Bone-Handled
Utensils
Handles may separate.
Iron Iron will rust. Hand wash and dry
immediately.
Non-Dishware
Items
Your dishwasher is intended for
use in cleaning ONLY standard
household dishware and
kitchenware.
Pewter, Brass,
Bronze
These items will tarnish. Hand
wash and dry immediately.

21
Rinse Aid en-us
Loading the racks
For best dishwashing results, observe the following
when loading the dishwasher:
ʑ Do not pre-wash items with loosely attached food
soil.
ʑ Remove all food particles, bones, toothpicks and
excessive grease.
ʑ Pre-treat items having burned-on, baked-on or
starchy soils.
ʑ Load dishes in the dishwasher racks so the insides
of bowls, pots and pans are facing the spray arms.
ʑ Avoid nesting and contact points between dishes.
ʑ Separate items of dissimilar metals. Use care to not
block movement of the spray arms.
ʑ Only wash household dishware and kitchenware
rated as dishwasher-safe.
Refer to the Dishware Materials section for more
information about dishware suitability.
NOTICE: To avoid dishwasher damage, do not load
the dishwasher with paper products, plastic bags,
packing materials or anything other than normal,
dishwasher safe dishware and kitchenware.
Loading the upper rack
Ensure items do not protrude through the bottom of the
racks and block the spray arms.
Note: When pushing the upper rack 12 into the
dishwasher, push it until it stops against the back of the
tub so the upper rack spray arm 1: connects to the
water supply at the back of the tub. Do not push racks in
using the door.
Loading the lower rack
Place large items in the lower rack 1j. Load pots, pans
and bowls upside down.
Loading patterns
For daily, regular or typical use
Loading patterns for lower rack
Lower rack 1j
Alternate loading pattern with pots and pans
For best results, load large items face down in the lower
rack.

22
en-us Rinse Aid
Loading patterns for upper rack
12 place setting suggested loading pattern, with
cutlery drawer
Alternate loading pattern
Alternate loading pattern with stemware
Use supports to load stemware glasses in the upper
rack.
Loading patterns for third rack
12 place setting suggested loading pattern *

23
Rinse Aid en-us
Unloading the dishwasher
CAUTION!
Dishes can be very hot immediately after cycle
ends. Open the door slightly and allow dishes to
cool for a few minutes before unloading.
Note: Dishes are more likely to chip when unloading
before cooling.
When unloading the dishwasher, to prevent water from
dripping onto dry dishes, unload the lower
rack 1j first. Next, unload the silverware
basket 1b followed by the upper rack 12, and then
the third rack (if equipped).
Adjusting the height of the rack
Ad j u s t i n g the hei gh t of the rack
The height of the upper rack 12 can be adjusted to
create more space for taller utensils either in the upper
or lower rack.
Arrange large plates up to a diameter of 12.25 in
(31 cm) in the lower basket 1j as illustrated.
RackMatic
®
System
The height of the upper rack 12 can be adjusted in
3 steps to create more space for larger items in the
lower rack.
1. Pull the upper rack out of the dishwasher until it
stops.
2. To lower the rack, push the RackMatic® lever inward.
3. To raise the rack, hold the basket on the sides of the
upper rack and lift it up.
Note: Check spray arm for clearance after adjustment.
Upper rack Lower rack
Setting 1 max. ø 7 in (18 cm) 12.25 in (31 cm)
Setting 2 max. ø 8 in (20.5 cm) 11.5 in (29 cm)
Setting 3 max. ø 9 in (23 cm) 10.5 in (26.5 cm)

24
en-us Rinse Aid
Removing/Installing third rack
Removing third rack 1*
1. Pull out third rack all the way (1).
2. Lift upper rollers over the stopper hooks of both rails
(2).
3. Pull third rack out forward and upward so that the
holding hooks and the lower rollers of the rack slide
over the stopper hooks of both rails (3).
Installing third rack 1*
1. Pull out third rack rails all the way (1).
2. Insert third rack at an angle. Make sure that the
stopper hooks of both rails slide in between the
holding hooks and the lower rollers of the third
rack (2).
3. Slide third rack in and lift the upper rollers over the
front stopper hooks of both rails (3).
4. Push in third rack (4).

25
Rinse Aid en-us
Removing/Installing upper rack with
Rackmatic
®
Removing upper rack 12
1. Pull out upper rack all the way (1).
2. Lift front rollers over the stopper hook of the rail (2).
3. Pull out upper rack forwards and upwards so that the
upper and lower rollers of the rack slide over the
stopper hooks of both rails (3).
Installing upper rack 12
1. Pull out upper rack rails all the way (1).
2. Insert upper rack at an angle. Make sure that the
stopper hooks of both rails slide in between the
upper and lower rollers on the rear side of the
rack (2).
3. Slide upper rack in and lift the upper rollers over the
front stopper hooks of both rails (3).
4. Push in upper rack (4).

26
en-us Rinse Aid
Rack features
Flip tines
Depending on the features of your dishwasher, the tines
can be folded down. This facilitates arrangement of
pots, bowls and glasses.
Fold down the flip tines as follows:
1. Pull flip tine gently forward and release it from the
notch (1).
2. Push the flip tine downward to the desired
position (2).
To fold up, push flip tines into an upright position until
the holder engages in the notch.
Third rack
The third rack horizontally positions knives, spatulas
and other oversized tools for improved cleaning and
easier loading and unloading. Arrange cutlery in third
rack as illustrated.
Cup shelves
The cup shelves and the space underneath them can be
used for small cups or for larger serving utensils.
&/,&.

27
Rinse Aid en-us
Stemware support
The lower rack accommodates two rows of stemware by
placing glasses on angled flip tines and resting the
stems against the wine stem bar and cup shelves.
Extra tall item sprinkler
If an item is too tall to be placed in the lower rack 1j
even with the upper rack 12 in the raised position,
remove the empty upper rack 12 by pulling it out of the
dishwasher until it stops. Pull the front of the rack
upward and outward until the rack will not slide out
anymore. Then lift it up and away from the dishwasher,
until the rollers are completely free of the roller
guides (A).
Set the upper rack 12 aside and push the roller
guides (A) back into the dishwasher. Insert the extra tall
item sprinkler (B) into the upper rack spray outlet (C)
and turn the sprinkler clockwise to lock into position.
NOTICE: To avoid dishwasher damage, do not reinstall
the upper rack 12 without removing the extra tall item
sprinkler (B).
$
$
%
&

28
en-us Detergent
.
Detergent
Detergent
Use only detergent specifically designed for
dishwashers. For best results, use fresh powdered
dishwashing detergent or detergent tabs.
NOTICE:
To avoid damage to dishwasher or dishware:
ʑ Do not use hand dishwashing products in your
dishwasher.
ʑ Do not use too much detergent if your water is soft.
Using too much detergent with soft water may cause
etching in glassware and fine china.
ʑ To best protect glassware, use a wash cycle with low
temperatures or a specific glass-care cycle
(depending on the model) and use a detergent that
includes etch protection.
Note: If you do not know the hardness of your water
supply, use 15 ml of detergent. Increase the amount if
necessary to the least amount required to get your
kitchenware clean.
Adding detergent
1. If the detergent dispenser 9* is still closed, actuate
locking bar 92 to open it.
2. Pour detergent into the dry detergent dispenser 9*
only. Do not overfill the detergent dispenser.
When using detergent tabs, lay them such that they
do not come in contact with the cover, insert a
detergent tab flat, not on its side.
Note:Do not place detergent tabs in the tab tray 1B.
Place tabs or other detergent forms directly in the
detergent dispenser 9*.
3. Dosage: see manufacturer’s instructions on
the packaging. Use graduated detergent dispenser.
Usually 1¼ to 1½ tablespoons (20 ml–25 ml) are
adequate for normal soiling. If using tablets, one
tablet is adequate.
4. Close cover on the detergent dispenser.
Cover “clicks” into position.
The detergent dispenser opens automatically at the
optimum time depending on the wash cycle. The
powder or liquid detergent is distributed in the
appliance and is dissolved, the detergent tab falls
into the detergent tab tray where it dissolves in
doses.
Tip: If the utensils are only lightly soiled, slightly less
than the indicated amount of detergent is usually
adequate.
Suitable detergents and care products can be
purchased online via our website or via customer
service (see back page).
WEVS
êWEVS
PO
êWEVS
PO
PO
&/,&.

29
Detergent en-us
Combination detergent
Apart from conventional single function detergents, a
number of products are offered with additional
functions. These products contain not only the
detergent but also rinse aid and salt replacement
substances (3in1) and, depending on the combination
(4in1, 5in1, ...), additional components such as glass
protection or stainless steel cleaner. Combination
detergents function only up to a specific degree of
hardness (usually 21°dH). Over this limit salt and rinse-
aid must be added.
As soon as combined detergents are used, the rinse
programme is adjusted automatically to ensure the best
possible rinsing and drying result.
Notes
ʑ If you want to add more utensils after the wash cycle
has started, do not use the detergent tab tray 1B as
a handle for the upper rack. The detergent tab could
already be there and you will touch the partially
dissolved tab.
ʑ Do not place small parts for washing in the detergent
tab tray 1B; this prevents the detergent tab from
dissolving evenly.
ʑ You will obtain optimum rinsing and drying results
by using single function detergents and applying salt
and rinse aid separately.
ʑ If wash cycles are short, detergent tabs may not have
full cleaning effect due to different dissolving
properties and there may even be undissolved
detergent residue. It is recommended to use washing
powder for these wash cycles.
ʑ The dosing of a detergent tab is adequate for the
“Intensive” wash cycle (for some models). When
using washing powder, you can apply some of this
cleaning agent to the inside of the appliance’s door.
ʑ Even if the rinse-aid and/or salt refill indicator is lit,
the rinse cycle will run correctly with combined
detergents.
ʑ If using detergents in a water-soluble protective
cover: Take hold of the cover with dry hands only
and put the detergent into an absolutely dry
detergent dispenser only, otherwise the detergent
may stick.
ʑ If you switch from combined detergents to single
function detergents, ensure that the water softening
system and amount of rinse aid have been set to
the correct value.
ʑ Biological/eco detergents: Detergent products
identified as “Bio” or “Eco” (to protect the
environment) usually use lower quantities of active
agents or completely dispense with certain
substances. The cleaning effect of such products
may occasionally be restricted.

30
en-us Dishwasher Cycles
/
Dishwasher Cycles
Dishwasher Cycles
Note: In order to save energy, it is recommended to set
the Auto Power Off feature to “After one minute”.
Note: The Energy Guide label was based on the Normal or Regular soil sensing cycle as follows: The unit was tested
without any rinse aid (liquid) in the rinse aid dispenser 9". A single dose of detergent was inserted into the
detergent dispenser 9*, with no detergent being used in the prewash. The unit was not subjected to truncated
testing per the definitions in the test procedure. We recommend that dish loads such as the one in the energy
certification test have the rack position set in the highest position.
Wash cycle Recommended use Possible wash cycle option
AUTO
150 - 160° F
This cycle cleans items having baked-on or hard dried-on
food soils. These items may require soaking or hand
scouring.
all
AUTO Wash
130 - 150° F
This cycle is appropriate for mixed loads.
It is optimised according to the soiling with the aid of
sensors.
all
Regular
(see note at bottom of
table)
Recommended for daily, regular or typical use to
completely wash a full load of normally soiled dishes.
all
Note:In order to obtain
optimal performance with
minimum energy
consumption, it is
recommended to disable all
available options and
settings, except Auto Power
Off
Quick Wash
Cleans lightly soiled dishes with easy to remove food
soils.
Extra Dry
Glass Care
A cycle for lightly soiled dishes which is ideal for
temperature sensitive dishes or silverware. In this cycle
the temperature is reduced to help prevent dishes from
becoming damaged. It is especially helpful to reduce a
cloudy or etched appearance on glasses.
Note:Some glasses are more prone to etching due to the
glass manufacturing process.
all
Rinse
Use this cycle if you need to pre-rinse dishes to avoid
odors. Place unrinsed dishes inside the dishwasher and
select the Rinse cycle. Uses less water than hand rinsing
and very low energy.

31
Dishwasher Cycle Options en-us
0
Dishwasher Cycle Options
Dishwasher Cycle Opti ons
Intensive Zone Ï
Intensive Zon e
Perfect for a mixed load. You can wash very soiled pots
and pans in the lower rack together with normally soiled
utensils in the upper rack. The spray pressure in the
lower rack is intensified, the rinsing temperature is
increased slightly.
Turbo ¥
Turbo is an option that allows saving time without
sacrificing wash and dry performance. Selecting this
option ensures the same final temperatures as the
underlying cycle by starting the heat period at an earlier
phase in the program. Selecting this option also
increases energy consumption while reducing cycle
time.
Extra Dry ½
Ex t r a Dry
An increased temperature during the final rinse and an
extended drying phase ensure that even plastic parts
dry better. There is a slight increase in the energy
consumption.
Wash Cycle Information
To save energy, this dishwasher has EcoSense where
the sensors in the dishwasher automatically adjust the
cycle length, temperature and water changes based on
the amount of food soil and the incoming water
temperature. The “Smart Control” makes decisions that
can cause the cycle time and water usage to adjust
intermittently. Wash cycle times are based on 120°F
(49° C) water supply. If your household water supply is
different than 120°F (49° C), your dishwasher’s cycle
times may be impacted.
Note: Only sanitizing cycles have been designed to meet the requirements of Section 6 of the NSF/ANSI Standard
for Residential Equipment for soil removal and sanitization efficacy. There is no intention, either directly or indirectly,
to imply that all cycles have passed sanitization performance tests.
AUTO Wash
130-150°F
AUTO*
150-160°F
Normal Quick Wash Glass Care Rinse
Cycle time
in min.
105 - 130 110 - 135 130 - 135 30 70 9
Water cons. in L (gal) 9.4-20.2
(2.5-5.3)
18.6-24.2
(4.9-6.4)
8.5-20.6
(2.2-5.4)
10.5 (2.8) 13 (3.4) 4.1 (1.1)
Wash temp. in °F (°C) 127-131
(53-55)
151-160
(66-71)
113-131
(45-55)
113 (45) 122 (50) incoming
Rinse temp. in °F (°C) 153-162
(67-72)
162 (72) 140-156
(60-69)
127 (53) 140 (60) incoming
Intensive Zone
Cycle time
in min.
120-145 125-145 145-150 N/A 85 N/A
Water cons. in L (gal) 9.4-20.2
(2.5-5.3)
18.6-24.2
(4.9-6.4)
8.5-20.6
(2.2-5.4)
N/A 13 (3.4) N/A
Rinse temp. in °F (°C) 153-162
(67-72)
162 (72) 156 (69) N/A 140 (60) N/A
Turbo
Cycle time
in min.
75-90 95-110 95-105 N/A 60 N/A
Water cons. in L (gal) 16.1-20
(4.3-5.3)
16.3-20.5
(4.3-5.4)
16.6-21.1
(4.4-5.6)
N/A 13.3 (3.5) N/A
Rinse temp. in °F (°C) 153-162
(67-72)
162 (72) 162 (72) N/A 140 (60) N/A
Extra Dry
Cycle time
in min.
125-150 130-150 140-155 50 100 N/A
Water cons. in L (gal) 9.4-20.2
(2.5-5.3)
18.6-24.2
(4.9-6.4)
8.5-20.6
(2.2-5.4)
10.5 (2.8) 13 (3.4) N/A
Rinse temp. in °F (°C) 162 (72) 162 (72) 162 (72) 162 (72) 162 (72) N/A
*sanitize

32
en-us Operating the Dishwasher
1
Operating the Dishwasher
Operati ng the Dishwasher
Note: With hidden controls, the door must be opened
before changing settings and closed after changing
settings.
WARNING
Risk of injury!
To avoid risk of injury, always use caution when
opening the door during or following a wash cycle
as hot water or steam may escape. Do not fully
open the door until water noises have stopped
and steam has subsided.
Protection against unintentional
operation
Your dishwasher is equipped with a function that helps
to prevent unintentional operation (e.g. by children).
After starting the dishwasher, the dishwasher door has
to be closed within 4 seconds, otherwise the operation
will be paused. There will be a signal on the control
panel advising you to press the Start button again and
close the door.
This function will be activated when:
ʑ pressing Start to begin a wash cycle
ʑ setting Delay time and pressing Start
ʑ opening the door while Delay time is active
ʑ opening the door during a wash cycle.
Note: This function cannot be deactivated.
Operating the touch buttons
Buttons are sensitive and should be touched gently.
Avoid any grease or food particles resting on the
buttons as they could activate the dishwasher.
Wiping and cleaning can also activate the dishwasher.
For best results, use bare, clean hands when touching
the buttons.
To clean the touch buttons wipe them with a dry or
slightly damp cloth.
Changing the settings
The dishwasher has been preset with certain settings
for your convenience. You can change these factory
settings.
Change the setting as follows:
1. Open the door.
2. Switch on On/Off button (.
3. Press Info button 8 for 3 seconds until the
following text is indicated in the digital display @:
Scroll with < >
Set with - +
Leave with Setup 3 sec.
4. Keep pressing button > ` until the required setting
is indicated in the display window at the top @.
5. Make the selection with setting buttons + -X.
6. Press and hold the Info button 8 for 3 seconds.
The chosen setting has now been stored.
Tip: If you change several settings, first make all
changes in succession. Now press the Info button 8
for 3 seconds. This saves all set values in the appliance.

33
Operating the Dishwasher en-us
AquaSensor
The AquaSensor is an optical measuring device which
measures the cleanliness of the rinse water.
The AquaSensor is used according to the wash cycle. If
the AquaSensor is active, “clean” rinse water can be
transferred to the next rinse and water consumption can
be reduced by 0.8–1-5 gal (3–6 liters). If the rinse water
is not yet clear, the water is drained and is replaced with
fresh water. In the automatic wash cycles the
temperature and running time can also be adjusted to
the degree of soiling.
Time display
The wash cycle time is determined during the wash
cycle by the water temperature, the amount of dishes, as
well as the degree of soiling and may vary (depending
on the selected wash cycle). You can change the time
display into time of day or hours/minutes so that the
remaining cycle time of the wash cycle appears in the
display window “Finish at” (for example 15:20 o’clock)
or “Finish in” (for example 3:25 hours).
Sensor setting
The wash cycle sequence is optimized in Auto wash
cycles with the aid of sensors. The sensors adjust the
wash cycle strength of Auto wash cycles depending on
the amount and type of soiling. You can adjust the
sensitivity of the sensors in 3 stages.
Standard: This setting is recommend for daily regular or
typical use. This is the most energy efficient setting.
Sensitive: This setting adjusts the wash cycle strength
for the effective removal of food remnants, even if the
amount of soiling is low. The energy and water
consumption is increased accordingly.
Very sensitive: This setting adjusts the wash cycle
strength for difficult conditions of use, for example
firmly dried on food remnants. This setting is
recommended if using biological or eco detergents
which contain lower amounts of active agents. The
energy and water consumption is increased accordingly.
Extra Dry
The final rinse uses a higher temperature which
improves the drying result. The cycle time may increase
slightly. (Caution if utensils are delicate!) You can
switch the Extra Dry function on or off. There is a slight
increase in energy consumption.
Eco forecast
When Eco forecast is activated, the average water and
energy consumption of the selected wash cycle is
briefly displayed in the digital display @.
Auto power off
This setting determines the length of time the control
panel stays illuminated after the cycle is complete.
To save energy, the recommended setting is “after one
minute”.
Possible settings are:
ʑ off: The appliance does not switch off automatically.
ʑ After one minute: The appliance switches off after
1 minute. This is the most energy efficient setting.
ʑ After two hours: The appliance switches off after
2 hours.
Tone volume
The end of the wash cycle is indicated by a buzzer. You
can also change this setting.
Button volume
When you are operating the dishwasher, a signal
sounds whenever a button is pressed. You can control
the volume of the signal. If you do not like the button
volume, you can switch it off.

34
en-us Operating the Dishwasher
Greeting
When you switch on the dishwasher, the brand logo
appears. You can switch off the brand logo.
Factory setting
You can reset all settings to the factory setting.
Switching the appliance on
1. Turn the water supply on fully.
2. Open the door.
3. Switch on On/Off switch (.
The Auto wash cycle has been preset as a default
whenever the appliance starts. This wash cycle
remains selected if no other wash cycle button 0
is pressed.
4. Press Start button )*.
5. Close the door.
Wash cycle sequence starts.
Note: Your dishwasher is protected against
unintentional operation. If the appliance door remains
open for more than 4 seconds after pressing the Start
button, the operation will be paused. Press the Start
button again and close the appliance door.
Delay start time
You can delay the start of the wash cycle by up to
24 hours. Depending on the setting of the time display,
the end of cycle is indicated with “Finish in” (for
example 3h 25m) or “Finish at” (for example 15:20
hours).
1. Open the door.
2. Switch on On/Off switch (.
3. Select wash cycle 0.
4. Press Delay start button `.
5. Keep pressing the setting buttons + - X until the
displayed time corresponds with your requirements.
6. Press Start button )*, timer programming is
activated.
7. To delete the Delay start time, press Start button )*
for about 3 seconds.
8. Close the door.
Note: Your dishwasher is protected against
unintentional operation. If the appliance door remains
open for more than 4 seconds after pressing the Start
button, the operation will be paused. Press the Start
button again and close the appliance door.
InfoLight
® *
* depending on the features of your dishwasher
While the wash cycle is running, a light spot shines on
the floor under the appliance door.
Do not open the appliance door until the light point is
no longer visible on the floor.
If the appliance door is not completely closed, the light
spot flashes.
If the appliance is installed at eye-level, with flush
furniture front, the light point is not visible.
In darkened rooms, some light scattering may be visible.
This is normal and cannot be changed.
You can switch the Infolight on or off.

35
Operating the Dishwasher en-us
EmotionLight
The EmotionLight 1" is on when the door is open
irrespective of whether the On/Off switch ( is
switched on or off. When the door is closed, the
EmotionLight is off. You can switch the EmotionLight on
or off.
Note: Note that when the door is open the EmotionLight
is automatically switched off after 1 hour.
Wash cycle end
The wash cycle has ended when “Finished” is indicated
on the digital display(s).
Switching off the appliance
Short time after the end of the wash cycle:
1. Press On/Off button (.
2. Remove the dishes when they have cooled down.
WARNING
Risk of injury!
To avoid risk of injury, always use caution when
opening the door during or following a wash cycle
as hot water or steam may escape. Do not fully
open the door until water noises have stopped
and steam has subsided.
Interrupting the wash cycle
CAUTION!
Expansion (overpressure) may cause the
appliance door to open and/or water to escape! If
the door was opened on an appliance which has a
hot water connection or is heated, always leave
the door ajar for several minutes and then close.
1. Open the door.
2. Switch off On/Off switch (.
The LED’s go out. The wash cycle is saved.
3. To continue the wash cycle, switch on the On/Off
switch ( again.
4. Close the door.
Note: Your dishwasher is protected against
unintentional operation. If the appliance door remains
open for more than 4 seconds after pressing the Start
button, the operation will be paused. Press the Start
button again and close the appliance door.
Cancel a cycle (reset)
1. Open the door and press and hold the Start button
)* for approximately 3 seconds until the digital
display @ shows: "Program was terminated".
2. Close the door.
3. Wait about 1 minute while the dishwasher drains.
4. Open the door and press the On/Off switch (.
Changing the wash cycle
When the Start button ( has been pressed, the wash
cycle cannot be changed. The only way a wash cycle can
be changed is by terminating the wash cycle (Reset).

36
en-us Care and Maintenance
2
Care and Maintenance
Care and Maintenance
A regular inspection and maintenance of your machine
will help to prevent faults. This saves time and prevents
future problems.
Cleaning the dishwasher
ʑ Check rinsing compartment for grease and limescale
deposits.
If you find such deposits:
ʑ Fill detergent dispenser 9* with detergent. Start
the appliance without utensils in the wash cycle with
the highest rinsing temperature.
WARNING
Health hazard due to detergents containing
chlorine!
Always use chlorine-free detergents.
ʑ Regularly wipe the front of the appliance with a damp
cloth - water and a small amount of liquid soap is
adequate.
ʑ For black stainless steel and anti-fingerprint
surfaces, use a soft, dry towel. For stubborn dirt, use
warm water diluted with a non-abrasive, mild
cleansing soap. Never use stainless steel polish.
ʑ For stainless steel appliances (excluding black
stainless and anti-fingerprint), use a stainless steel
polish to seal and protect the surface.
ʑ Clean the outer edges of the inside door panel
regularly to remove debris that may collect from
normal loading. If spots begin to appear on the
stainless steel, make sure the rinse aid dispenser is
full and functioning properly.
ʑ Clean the door seal regularly with a damp cloth to
remove food particles that may collect from normal
loading and cause odor. A soiled door seal may not
seal properly.
NOTICE:
ʑNever use a steam cleaner to clean your
dishwasher. The manufacturer is not liable for any
resulting damage.
ʑ Do not use sponges as they could scratch the
surfaces.
ʑ Do not use bleach-based wipes as they could
damage the surface or printing.
ʑ Never use stainless steel polish on a black stainless
finish or anti-fingerprint surfaces.
WARNING
Use caution when removing parts for cleaning as
some debris may be sharp.
Special salt and rinse aid
Top off the salt and/or rinse aid as soon as the refill
indicators on the fascia P and H are lit.
Filters
Filter components
The filter system 1Z consists of three parts.
A Large Object Trap
Prevents objects that should not be placed in
your dishwasher from damaging the dishwasher
pump system or clogging your household drain.
B Flat Fine Filter
Prevents food particles from entering the wash
chamber and directs particles toward the micro
filter.
C Micro Filter
Directs the smallest of particles to the household
plumbing drain.
$
%
&

37
Care and Maintenance en-us
Cleaning intervals
The filter system 1Z is designed to minimize
maintenance while providing premium cleaning
performance and minimum energy consumption.
Depending on use habits and water hardness, the filter
system will require some maintenance to sustain
premium cleaning performance.
Your filter system may need to be cleaned when:
ʑ You notice food soils remaining on the filter system
or objects trapped in the Large Object Trap.
ʑ A drop in cleaning performance or a gritty film forms
on the dishware.
When washing normally attached food soils that have
been scraped before loading, in a household that runs
the dishwasher every other day, your filter should be
cleaned:
Note: Clean the filter after washing loads with large
amounts of food soils or loads with a heavy starch
content to maintain optimal performance.
To check or clean the filter system:
1. After each wash cycle check the filters for residue.
2. Unscrew the Large Object Trap as illustrated and
remove the entire filter system.
3. Remove the microfilter from the fine filter for easier
cleaning.
4. Rinse the filters under running water and use a soft
brush to clean.
Note:do not use abrasive brushes or steel wool, etc.,
as they may damage the filter.
5. Reinstall the filter system in reverse sequence and
lock into place by screwing the Large Object Trap
until the marking arrows align.
Cleaning interval Usage
3- 6 times a year light to average use
8-12 times a year heavy use

38
en-us Care and Maintenance
Spray arms
Limescale and contaminants in the rinsing water may
block nozzles and bearings on the spray arms 1:
and 1J.
1. Check outlet nozzles on the spray arms
for blockages.
2. Unscrew the upper spray arm 1: (1) and remove
downwards (2).
3. Remove the lower spray arm 1J upwards.
4. Clean spray arms under running water.
5. Re-engage or screw on spray arms.
Drain pump
Large food remnants in the rinsing water not retained by
the filters may block the waste water pump. In this case:
WARNING
Use caution when removing parts for cleaning as
some debris may be sharp.
1. Disconnect the appliance from the power supply.
2. Take out upper rack 12 and lower rack 1j.
3. Remove the filters 1Z.
4. Scoop out standing water - use a sponge if
necessary.
5. Using a spoon, pry off the pump cover (as shown)
until it clicks, then grip the cover and pull upward
until it resists and then pull forward (1). Remove
cover completely.
6. Check inner compartment and remove any foreign
objects.
WARNING
Use caution when removing parts for cleaning as
some debris may be sharp.

39
Care and Maintenance en-us
7. Place pump cover in the original position (2) and
press down until it engages (3).
8. Place cover in the original position, press down and
engage.
9. Reinstall filters.
10. Re-insert racks.
Note: The drain pump will not work properly if the drain
pump cover is not snapped in completely until it clicks.
Preparing your unit for vacation
NOTICE: Before leaving for vacation during warmer
weather, besides turning off the main valve, also turn off
water supply at the nearest point to the dishwasher. Do
not leave soiled dishware in unit and leave door slightly
open. During colder weather, please follow the
instructions for winterizing your unit below.
Winterizing your unit
NOTICE: If your dishwasher will be unused for a
period of time in a location that experiences freezing
temperatures (holiday home or through a vacation
period), have your dishwasher winterized by a
professional service.
&OLFN

40
en-us Troubleshooting
3
Troubleshooting
Troubleshooti ng
Dishwashers may occasionally exhibit problems that are
unrelated to a malfunction of the dishwasher itself. The
following information may help you with a dishwasher
problem without involving a repair professional.
Note: If the appliance stops during dishwashing or does
not start for any obvious reason, first run the cancel
wash cycle function (Reset).
WARNING
Improper repairs or use of non-original
replacement parts may cause considerable
damage and put the user at considerable risk!
Always have repairs carried out by authorized
technicians. If a component has to be replaced,
always use original replacement parts.
Error message
Some faults are indicated at the top of the display
window @ and on the front display * ): and possible
remedies are offered (for example Filter system soiled
(E22) -->Clean filters).
* optional feature which may or may not be included with
your dishwasher.
Fault table
Fault Cause Remedial action
Error code §:³µ is lit. Supply hose kinked. Install supply hose without kinks.
Tap turned off. Turn on the tap.
Tap jammed or calcified. Turn on the tap.
Flow rate must be min. 10 l/min. when water
supply is open.
Filter in the water supply blocked. Switch off the appliance and pull out the
mains plug. Turn off the tap. Unscrew water
connection.
Clean filter in the supply hose. Screw water
connection on again. Check for leaks.
Reconnect power supply. Switch on the
appliance.
Error code §:¯Å is lit. Intake opening (on right inside of
appliance) covered by dishes.
Arrange dishes so that the intake opening is
not obstructed.
Error code §:³ is lit. Heating element calcified or soiled. Clean appliance with dishwasher cleaning
agent or descaler. Operate the dishwasher
with water softening system and check the
setting.
Error code §: is lit. Filters 1Z are soiled or blocked. Clean filters.
Error code §: is lit. Waste-water hose kinked or blocked. Install hose without kinks, remove any
residue.
Siphon connection still sealed. Check connection to siphon and open if
required.
Cover on the drain pump loose. Lock cover correctly.

41
Troubleshooting en-us
Error code §: is lit. Drain pump blocked or cover on the
drain pump is not locked in position.
Clean pump and lock cover correctly.
Error code §:Å is lit. Mains voltage too low. Not an appliance fault, have the mains
voltage and electrical installation checked.
A different error code is
indicated on the digital display.
(§:¯³ to §:´¯)
A technical fault has probably
occurred.
Switch off appliances with the ON/OFF
switch (. After a short time restart the
appliance.
If the problem recurs, turn off the tap and
pull out the mains plug.
Call customer service and mention the error
code.
Home network is not loading. Wi-Fi is not active on the router. Check the wireless network connection of
your router.
Wi-Fi display flashes Connection to the home network is
not available.
Activate the wireless network on your router.
Home Connect cannot be
implemented correctly.
Possible setting errors or a technical
fault.
Observe the supplied documents and
support information for Home Connect.
Refill indicator for salt P and/
or rinse-aid H is lit.
No rinse aid. Refill rinse aid.
No salt. Refill with special salt.
Sensor does not detect salt tablets. Use different special salt.
Refill indicator for salt P and/
or rinse-aid H is not lit.
Refill indicator switched off. Activation/deactivation a "
,
Rinse Aid", a "
+
Water softening system / special salt"
There is still enough special salt/
rinse aid available.
Check refill indicator, levels.
Water is left in the appliance at
the end of the wash cycle.
Filter system or area under the filters
1Z is blocked.
Clean filters and area underneath.
Wash cycle has not ended yet. Wait until wash cycle ends or reset.
Dishes not dry. No or too little rinse aid in the
dispenser.
Refill rinse aid.
Wash cycle selected without drying. Select wash cycle with drying.
Water collecting in depressions on
the dishes and silverware.
Arrange dishes in a sloping position,
arrange affected dishes as sloping as
possible.
The combined detergent used has a
poor drying performance
Use different combination detergent with
better drying performance. Use of rinse aid
also increases the drying performance.
extraDry to increase drying not
activated.
Activate extraDry.
Dishes were removed too early or
drying process had not ended yet.
Wait until wash cycle ends or wait until 30
min after wash cycle ends before removing
dishes.
The eco rinse aid used has a limited
drying performance.
Use a proprietary rinse aid. Eco products
may have limited effectiveness.
Plastic dishes not dry. Special properties of plastic. Plastic has a lower heat storage capacity
and therefore dries less well.
Fault Cause Remedial action

42
en-us Troubleshooting
Silverware not dry. Silverware not arranged properly in
the silverware basket.
Separate silverware if possible, prevent
contact points.
Silverware not arranged properly in
the third rack.
Arrange silverware properly and separate if
possible.
Appliance interior wet after rinse
cycle.
No appliance fault. On account of the “Condensation drying”
principle, water droplets are physically
induced and required in the container. The
humidity in the air condenses on the inner
walls of the dishwasher, drains and is
pumped out.
Food soils on the dishes. Dishes placed too closely together,
racks overfilled.
Arrange dishes with adequate clearance
between them ensuring that the spray jets
can reach the surface of the dishes. Prevent
contact points.
Spray arm rotation obstructed. Arrange dishes so that the spray arm can
rotate without obstruction.
Spray arm nozzles are blocked. Clean the spray arm nozzles.
Filters 1Z dirty. Clean filters.
Filters 1Z inserted incorrectly and/
or not engaged.
Insert and engage filters correctly.
Rinse wash cycle too weak. Select a more intensive rinse cycle.
Increase sensitivity of the sensors.
Dishes precleaned too intensely;
sensors therefore decide on weak
wash cycle sequence. Stubborn
soiling cannot be completely
removed.
Do not prerinse dishes. Remove only large
food soils.
Increase sensitivity of the sensors.
Recommended wash cycle "Regular" or
Intensive.
Tall narrow containers in corner areas
are not rinsed adequately.
Do not place hollow containers too
obliquely and do not place in the corner
area.
Upper rack 12 on right and left not
set to same height.
Set upper rack to same height using side
levers.
Dishwasher seems to run a long
time
Incoming water is not warm enough. Before starting a cycle, run hot water faucet
at the sink closest to the dishwasher.
Cycle time can vary due to soil and
water conditions.
Sensors in the dishwasher automatically
increase the cycle time to ensure a good
wash when heavy soil is detected.
Rinse aid dispenser 9" is empty. Add rinse aid.
Dishwasher connected to cold water
supply.
Note:Check the typical wash cycle
length.
Verify dishwasher is connected to hot water
supply plumbing.
Fault Cause Remedial action

43
Troubleshooting en-us
Detergent residue. Detergent dispenser cover 9*
blocked by dishes and therefore does
not open fully.
Dishes must not be placed above the
detergent tab tray 1B. These may block the
lid of the detergent dispenser and prevent it
from opening fully.
Do not place dishes or fragrance dispenser
in the detergent tab tray.
Detergent dispenser cover 9*
blocked by the detergent tab.
Detergent tab must be inserted flat and not
upright.
Detergent tab used in the quick or
short wash cycle.
Dissolving time of the detergent is
not reached in the selected short
wash cycle.
Dissolving time of detergent tab too long for
a quick or short wash cycle.
Use a detergent powder or select a more
intensive wash cycle.
Washing effect and dissolving
performance are reduced after a
prolonged storage time or detergent
is very lumpy.
Change detergent.
Water stains on plastic parts. Droplet formation on plastic surface
is physically unavoidable. After
drying, water stains are visible.
Use a more intensive wash cycle (more
water changes).
Arrange dishes in a sloping position.
Use rinse aid.
If required, increase softening setting.
Washable or water-soluble
coatings in the container or on
the door.
Detergent substances are deposited.
These coatings cannot usually be
removed with chemicals (appliance
cleaner, ...).
Change detergent brand.
Clean appliance mechanically.
If there is a “white coating” on the
container floor, the water softening
system has been set very low.
Increase softening setting and change
detergent if required.
Salt dispenser cover 1R not closed. Close salt dispenser cover correctly.
Only for glasses: Initial glass
corrosion – can only apparently be
wiped off.
See “Glass and silverware damage”.
White, stubborn coatings;
limescale on the dishes,
container or door.
Detergent substances are deposited.
These coatings cannot usually be
removed with chemicals (appliance
cleaner, ...).
Change detergent brand.
Clean appliance mechanically.
Hardness range incorrectly set or
water hardness greater than
8.9 mmol/l.
Set water softening system according to
instructions for use or top up salt.
3 in 1 detergent or bio/eco detergent
not effective enough.
Set water softening system according to
instructions for use or use separate
detergents (proprietary detergent, salt,
rinse aid).
Underdosing of detergent. Increase detergent dosage or change
detergent.
Too weak rinse cycle selected. Select a more intensive rinse cycle.
Fault Cause Remedial action

44
en-us Troubleshooting
Tea or lipstick residue on the
dishes.
Too low rinsing temperature. Select wash cycle with higher washing
temperature.
Too little or unsuitable detergent. Use suitable detergent at correct dosage.
Dishes precleaned too intensely;
sensors therefore decide on weak
wash cycle sequence. Stubborn
soiling cannot be completely
removed.
Do not prerinse dishes. Remove only large
food soils.
Increase sensitivity of the sensors.
Recommended wash cycle "Regular"
Colored (blue, yellow, brown),
difficult to remove to non-
removable coatings in the
appliance or on stainless steel
dishes.
Film formation consisting of
ingredients from vegetables (e.g.
cabbage, celery, potatoes, noodles,
...) or the tap water (e.g. manganese).
Can be partly removed with machine cleaner
or by mechanical cleaning. Coatings are
harmless.
Film formation caused by metallic
components on silver or aluminum
silverware.
Can be partly removed with machine cleaner
or by mechanical cleaning.
Colored (yellow, orange, brown),
easily removable deposits inside
the appliance (mainly in the floor
area)
Film formation consisting of
ingredients from food soils and
substances from the tap water
(limescale), “soapy”
Check function of the water softening
system (refill with salt) or, if using combined
detergents (tablets), activate water
softening system.
Discoloration of the plastic parts
inside the appliance.
Plastic parts inside the appliance may
become discolored during the
service life of the dishwasher.
Discoloration is normal and will not impair
the function of the dishwasher.
Plastic parts discolored. Too low rinsing temperature. Select wash cycle with higher washing
temperature.
Dishes precleaned too intensely;
sensors therefore decide on weak
wash cycle sequence. Stubborn
soiling cannot be completely
removed.
Do not prerinse dishes. Remove only large
food soils.
Increase sensitivity of the sensors.
Recommended wash cycle "Regular"
Removable streaks on glasses,
glasses with metallic appearance
and silverware.
Too much rinse aid. Set rinse aid amount to lower setting.
No rinse aid added or setting too low. Add rinse aid and check dosage
(recommended setting 4–5).
Detergent residue in the final rinse
wash cycle section. Detergent
dispenser cover blocked by dishes
(cover does not open fully).
Detergent dispenser cover must not be
obstructed by dishes.
Do not place dishes or fragrance dispenser
in the detergent tab tray.
Dishes precleaned too intensely;
sensors therefore decide on weak
wash cycle sequence. Stubborn
soiling cannot be completely
removed.
Do not prerinse dishes. Remove only large
food soils.
Increase sensitivity of the sensors.
Recommended wash cycle “Regular”
Initial or existing, irreversible
clouding of glass.
Glasses not dishwasher-proof, only
suitable for dishwasher.
Use dishwasher-proof glasses.
Avoid long steam phase (standing time after
wash cycle ends).
Use wash cycle at lower temperature.
Set water softening system according to the
water hardness (if required one setting
lower).
Use detergent with glass protection
component.
Fault Cause Remedial action

45
Troubleshooting en-us
Rust spots on the silverware. Silverware not adequately rust-
resistant. Knife blades are frequently
more severely affected.
Use corrosion-resistant silverware.
Silverware will also rust if rusting
parts are rinsed at the same time (pan
handles, damaged utensil baskets,
etc.).
Do not wash rusting parts.
Salt content in the rinsing water too
high, as salt dispenser lock not
fastened firmly or salt was spilled
while being refilled.
Fasten salt dispenser lock firmly or remove
spilled salt.
Appliance cannot be switched
on or operated.
Malfunction. Disconnect appliance from the power
supply; pull out the mains plug or switch off
the fuse. Wait at least 5 seconds, then
connect the appliance to the power supply.
Appliance does not start. Mains fuse may have been blown or
circuit breaker tripped.
Check mains fuse or circuit breaker.
Door may not be properly latched. Press the main power switch to turn unit on.
Unit may not be turned on. Shut door completely.
Delay start may be engaged. To reset, refer to “Delay start” section in this
manual.
Child lock is activated. Deactivate the child lock. Refer to “Child
Lock” section in this manual if applicable.
The door may have been closed
without first selecting a cycle.
Select a cycle and close the door.
Power cord not inserted. Ensure that the power cord is plugged all
the way into the back of the appliance and
into the socket. Check that the socket
functions.
The water supply may not be
connected.
Check and turn on water supply.
The appliance door has not been shut
properly.
Close the door.
The door has been open for more
than 4 seconds after pressing the
START button.
Press the START button again and close the
appliance door within 4 seconds (see
“Protection against unintentional
operation”).
Wash cycle starts automatically. You did not wait until wash cycle
ended.
Perform reset.
(see “Canceling the wash cycle“).
Cover on the detergent
dispenser cannot be closed.
Detergent dispenser or cover guide
blocked by sticky detergent residue.
Remove detergent residue.
Detergent residue in the
detergent dispenser 9* or in
the detergent tab tray 1B.
Spray arms blocked by dishes,
therefore detergent is not rinsed out.
Ensure that the spray arms can rotate freely.
The detergent dispenser was damp
when filled.
Pour detergent into the dry detergent
dispenser only.
Appliance stops in the wash
cycle or wash cycle is
interrupted.
Door not closed properly. Close the door.
Do not place dishes or fragrance
dispenser in the detergent tab tray.
Upper rack presses against the door
and prevents door from being closed
securely.
Check whether rear panel is being pressed
in, e.g. by socket or by hose holder which
has not been removed.
Power and/or water supply
interrupted.
Restore power and/or water supply.
Fault Cause Remedial action

46
en-us Troubleshooting
--------
Filling valves making striking
noises.
Depends on domestic installation, as
appliance is not defective. No effect
on appliance function.
No remedial action possible.
Knocking or rattling noise. Spray arm strikes the dishes, dishes
not positioned correctly.
Position dishes so that the spray arms do
not strike the dishes.
If there is a low load, the water jets
strike the washing tank directly.
Load the appliance with more dishes or
distribute the dishes more evenly in the
dishwasher.
Light dishes move during the wash
cycle.
Arrange light dishes securely.
Unusual foam formation. Handwash liquid in the rinse aid
dispenser.
Immediately refill rinse aid dispenser with
rinse aid.
Rinse aid spilled. Remove rinse aid with a cloth.
Fault Cause Remedial action

47
Customer Service en-us
4
Customer Service
Customer Servi ce
Your dishwasher requires no special care other than
that described in the Care and Maintenance section of
this manual. If you are having a problem with your
dishwasher, before calling for service please refer to the
Troubleshooting Guide section of the manual. If service
is necessary, contact your dealer or installer or an
authorized service center. Do not attempt to repair the
appliance yourself. Any work performed by unauthorized
personnel may void the warranty.
If you are having a problem with your dishwasher and
are not pleased with the service you have received,
please take the following steps until the problem is
corrected to your satisfaction:
1. Contact your installer or the Gaggenau
®
authorized
service provider in your area.
2. E-mail us from the customer service section of our
website, www.gaggenau-usa.com
3. Call us at 877-442-4436
4. Write us:
Gaggenau
®
1901 Main Street, Suite 600
Irvine, CA 92614
USA
Please be sure to include your model information as
well as an explanation of the problem and the date it
started. You will find the model and serial number
information on the label located on the edge of the
dishwasher door. Please make a copy of your invoice
and keep it with this manual. The customer may be
required to show proof of purchase to validate warranty
coverage.
‡
Statement of Limited Product Warranty
Statement of Limited Product Warr anty
What this Warranty Covers & Who it
Applies to:
The limited warranty provided by BSH Home Appliances
(Gaggenau
®
) in this Statement of Limited Product
Warranty applies only to the Gaggenau appliance
(“Product”) sold to you, the first using purchaser,
provided that the Product was purchased:
ʑ for your normal, household (non-commercial) use,
and has in fact at all times only been used for normal
household purposes;
ʑ new at retail (not a display, “as is”, or previously
returned model), and not for resale, or commercial
use; and
ʑ within the United States or Canada, and has at all
times remained within the country of original
purchase. The warranties stated herein apply only to
the first purchaser of the Product and are not
transferable.
Gaggenau reserves the right to request proof of
purchase at the time any warranty claim is submitted to
confirm that the Product falls within the scope of this
limited product warranty.
Please make sure to return your registration card; while
not necessary to effectuate warranty coverage, it is the
best way for Gaggenau to notify you in the unlikely event
of a safety notice or product recall.
How Long the Warranty Lasts
Gaggenau warrants that the Product is free from
defects in materials and workmanship for a period of
seven hundred thirty (730) days (2 years) from the date
of purchase. The foregoing timeline begins to run upon
the date of purchase, and shall not be stalled, tolled,
extended, or suspended, for any reason whatsoever.
This Product is also warranted to be free from cosmetic
defects in material and workmanship (such as scratches
of stainless steel, paint/porcelain blemishes, chip,
dents, or other damage to the finish of the Product), for
a period of thirty (30) days from the date of purchase or
closing date for new construction. This cosmetic
warranty excludes slight color variations due to inherent
differences in painted and porcelain parts, as well as
differences caused by kitchen lighting, product location,
or other similar factors. This cosmetic warranty
specifically excludes any display, floor, “As Is”, or “B”
stock appliances.

48
en-us Statement of Limited Product Warranty
Repair/Replace as Your Exclusive
Remedy
During this warranty period, Gaggenau or one of its
authorized service providers will repair your Product
without charge to you (subject to certain limitations
stated herein) if your Product proves to have been
manufactured with a defect in materials or workmanship.
If a reasonable number attempts to repair the Product
have been made without success, then Gaggenau will
replace your Product (upgraded models may be
available to you, in Gaggenau’s sole discretion, for an
additional charge). All removed parts and components
shall become the property of Gaggenau at its sole
option. All replaced and/or repaired parts shall assume
the identity of the original part for purposes of this
warranty and this warranty shall not be extended with
respect to such parts. Gaggenau’s sole liability and
responsibility hereunder is to repair manufacturer-
defective Product only, using a Gaggenau-authorized
service provider during normal business hours. For
safety and property damage concerns, Gaggenau highly
recommends that you do not attempt to repair the
Product yourself, or use an unauthorized servicer;
Gaggenau will have no responsibility or liability for
repairs or work performed by a non-authorized servicer.
If you choose to have someone other than an authorized
service provider work on your Product, THIS WARRANTY
WILL AUTOMATICALLY BECOME NULL AND VOID.
Authorized service providers are those persons or
companies that have been specially trained on
Gaggenau products, and who possess, in Gaggenau’s
opinion, a superior reputation for customer service and
technical ability (note that they are independent entities
and are not agents, partners, affiliates or
representatives of Gaggenau). Notwithstanding the
foregoing, Gaggenau will not incur any liability, or have
responsibility, for the Product if it is located in a remote
area (more than 100 miles from an authorized service
provider) or is reasonably inaccessible, hazardous,
threatening, or treacherous locale, surroundings, or
environment; in any such event, if you request,
Gaggenau would still pay for labor and parts and ship
the parts to the nearest authorized service provider, but
you would still be fully liable and responsible for any
travel time or other special charges by the service
company, assuming they agree to make the service call.
Out of Warranty Product
Gaggenau is under no obligation, at law or otherwise, to
provide you with any concessions, including repairs,
pro-rates, or Product replacement, once this warranty
has expired.
Warranty Exclusions
The warranty coverage described herein excludes all
defects or damage that are not the direct fault of
Gaggenau, including without limitation, one or more of
the following:
ʑ Use of the Product in anything other than its normal,
customary and intended manner (including without
limitation, any form of commercial use, use or
storage of an indoor product outdoors, use of the
Product in conjunction with air or water-going
vessels);
ʑ Any party’s willful misconduct, negligence, misuse,
abuse, accidents, neglect, improper operation,
failure to maintain, improper or negligent installation,
tampering, failure to follow operating instructions,
mishandling, unauthorized service (including self-
performed “fixing” or exploration of the appliance’s
internal workings);
ʑ Adjustment, alteration or modification of any kind;
ʑ A failure to comply with any applicable state, local,
city, or county electrical, plumbing and/or building
codes, regulations, or laws, including failure to
install the product in strict conformity with local fire
and building codes and regulations;
ʑ Ordinary wear and tear, spills of food, liquid, grease
accumulations, or other substances that accumulate
on, in, or around the Product;
ʑ Any external, elemental and/or environmental forces
and factors, including without limitation, rain, wind,
sand, floods, fires, mud slides, freezing
temperatures, excessive moisture or extended
exposure to humidity, lightning, power surges,
structural failures surrounding the appliance, and
acts of God.

49
Installation and connection en-us
In no event shall Gaggenau have any liability or
responsibility whatsoever for damage to surrounding
property, including cabinetry, floors, ceilings, and other
structures or objects around the Product. Also excluded
from this warranty are Products on which the serial
numbers have been altered, defaced, or removed;
service visits to teach you how to use the Product, or
visits where there is nothing wrong with the Product;
correction of installation problems (you are solely
responsible for any structure and setting for the
Product, including all electrical, plumbing or other
connecting facilities, for proper foundation/flooring,
and for any alterations including without limitation
cabinetry, walls, floors, shelving, etc.); and resetting of
breakers or fuses.
TO THE EXTENT ALLOWED BY LAW, THIS
WARRANTY SETS OUT YOUR EXCLUSIVE REMEDIES
WITH RESPECT TO PRODUCT, WHETHER THE
CLAIM ARISES IN CONTRACT OR TORT (INCLUDING
STRICT LIABILITY, OR NEGLIGENCE) OR
OTHERWISE. THIS WARRANTY IS IN LIEU OF ALL
OTHER WARRANTIES, WHETHER EXPRESS OR
IMPLIED. ANY WARRANTY IMPLIED BY LAW,
WHETHER FOR MERCHANTABILITY OR FITNESS
FOR A PARTICULAR PURPOSE, OR OTHERWISE,
SHALL BE EFFECTIVE ONLY FOR THE PERIOD THAT
THIS EXPRESS LIMITED WARRANTY IS EFFECTIVE.
IN NO EVENT WILL THE MANUFACTURER BE LIABLE
FOR CONSEQUENTIAL, SPECIAL, INCIDENTAL,
INDIRECT, “BUSINESS LOSS”, AND/OR PUNITIVE
DAMAGES, LOSSES, OR EXPENSES, INCLUDING
WITHOUT LIMITATION TIME AWAY FROM WORK,
HOTELS AND/OR RESTAURANT MEALS,
REMODELLING EXPENSES IN EXCESS OF DIRECT
DAMAGES WHICH ARE DEFINITIVELY CAUSED
EXCLUSIVELY BY BSH, OR OTHERWISE. SOME
STATES DO NOT ALLOW THE EXCLUSION OR
LIMITATION OF INCIDENTAL OR CONSEQUENTIAL
DAMAGES, AND SOME STATES DO NOT ALLOW
LIMITATIONS ON HOW LONG AN IMPLIED
WARRANTY LASTS, SO THE ABOVE LIMITATIONS
MAY NOT APPLY TO YOU. THIS WARRANTY GIVES
YOU SPECIFIC LEGAL RIGHTS, AND YOU MAY ALSO
HAVE OTHER RIGHTS WHICH VARY FROM STATE TO
STATE. No attempt to alter, modify or amend this
warranty shall be effective unless authorized in writing
by an officer of BSH.
How to Obtain Warranty Service
To obtain warranty service for your Product, you should
contact the nearest Gaggenau authorized service
center.
5
Installation and connection
Installation and connecti on
The dishwasher must be connected correctly, otherwise
it will not function properly. The specifications
for the inlet and outlet as well as the electrical
connected loads must correspond with the required
criteria as specified in the following paragraphs or in
the installation instructions.
Install the appliance in the correct sequence:
1. Checking appliance on delivery
2. Installation
3. Drainage connection
4. Tap water connection
5. Electrical connection
Parts included
If you have any complaints, contact the dealer from
whom you purchased the appliance or our customer
services department.
ʑ Dishwasher
ʑ User manual
ʑ Installation instructions
ʑ Quick reference guide*
ʑ Warranty*
ʑ Installation materials
ʑ Steam guard plate*
ʑ Rubber apron*
ʑ Power cord
* depending on the features of your dishwasher
Safety instructions
Please refer to the Important Safety Instructions for
installation that are included in the separate Installation
Instructions for your appliance.

50
en-us Installation and connection
Delivery
Your dishwasher has been checked
thoroughly in the factory to ensure that it is in working
order. This may cause small water stains. These will
disappear after the first wash cycle.
Technical specifications
ʑ Weight:
up to 132 lbs (60 kg)
ʑ Voltage:
120 V, 60 Hz
ʑ Connected load:
1,440 W.
ʑ Circuit breaker:
12 A
ʑ Power input:
off mode (Po)* 0.50 W.
left on mode (Pl)* 50 W.
in networked standby mode 2.00 W.
*according to regulations (EU) nos. 1016/2010 and
1059/2010.
Additional functions and settings may increase the
power input.
ʑ Water pressure:
at least 7.25 PSI (0.5 bar), maximum 145 PSI (10
bar).
At a higher water pressure:
connect pressure-reducing valve ahead.
ʑ Inlet rate:
minimum 2.65 gallons/minute (10 liters/minute)
ʑ Water temperature:
Cold water.
Hot water:
Maximum temperature 140° F (60 °C).
ʑ Capacity:
12–15 place settings (depending on the features of
your dishwasher).
Installation
The required installation dimensions can be
found in the installation instructions. Level
the appliance with the aid of the height-adjustable feet.
Ensure that the appliance is situated
securely on the floor.
ʑ A built-under or integrated appliance which is
installed subsequently as a free-standing appliance
must be secured to prevent it from overturning, e.g.
by screwing it to the wall or by installing it under a
continuous worktop which is screwed to adjacent
cupboards.
ʑ The appliance can easily be installed in a fitted
kitchen between wooden and plastic walls.
Drain connection
1. The required work sequence can be
found in the installation instructions. If required, fit
a siphon with a drain connection.
2. Connect the drain hose to the drain
connection of the siphon with the enclosed parts.
Ensure that the drain hose is not kinked, crushed
or twisted and that there is no cover
plate in the drainage to prevent the drain water from
flowing out!

51
Installation and connection en-us
Water supply connection
1. Fasten the water supply connection to the tap
according to the installation instructions using
the enclosed parts.
Ensure that the water supply connection is not
kinked, crushed or twisted.
2. When replacing the appliance, always use a new
water supply hose.
Water pressure:
At least 7.25 PSI (0.5 bar), maximum 145 PSI (10 bar).
At a higher water pressure:
connect pressure-reducing valve ahead.
Inlet rate:
Minimum 2.65 gallons/minute (10 liters/minute)
Water temperature:
Cold water.
Hot water:
Maximum temperature 140° F (60 °C).
Hot water connection *
Hot wat er connect i on
The dishwasher can be connected to cold or hot water
up to max. 140° F (60 °C). Connection to hot water is
recommended if the hot water can be supplied by
energetically favourable means and from a suitable
installation, e.g. solar heating system with circulation
line. This will save energy and time. The “Hot water”
setting allows you to adjust your dishwasher optimally to
operation with hot water. It is recommended to have a
water temperature (temperature of the incoming water)
of at least 104° F (40 °C) and no more than 140° F
(60 °C). It is not recommended to connect the
appliance to hot water if the water is supplied from an
electric boiler.
To change the setting:
1. Open the door.
2. Switch on ON/OFF switch (.
3. Press Info button 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with W 3 sec.
4. Keep pressing the button > ` until water
connection appears of the display window at the top
@.
5. Make the selection with setting buttons + -X.
6. Press and hold the Info button 8 for 3 seconds.
The chosen setting has now been stored.
* optional feature which may or may not be included with
your dishwasher.

52
en-us Installation and connection
Electrical connection
ʑ Connect the appliance to an 120 V, 60 Hz alternating
current only, via a correctly installed outlet with
protective grounding conductor. See rating plate for
required fusing 9:.
ʑ The outlet must be near the appliance and freely
accessible after the installation.
If the plug is not freely accessible, an allpole
disconnector with a contact opening of at least 3 mm
must be fitted on the installation side to satisfy the
relevant safety instructions.
ʑ The connection may be modified by technicians only.
ʑ A power cord extension may be purchased from
customer service only.
ʑ Use only a residual current operated circuit-breaker
which features the symbol ‚. Only this extension
guarantees compliance with the currently valid
regulations.
ʑ The appliance features a water damage protection
system. Please note the system will function only
when the power supply is connected.
Removing the appliance
Also observe the sequence of worksteps here.
1. Disconnect the appliance from the power supply.
2. Turn off the tap.
3. Undo the drain water and water supply connection.
4. Loosen fastening screws for the cabinet parts.
5. If fitted, remove the base panel.
6. Pull out the appliance, carefully pulling the hose
behind.
Transporting the appliance
Empty the dishwasher and secure loose parts.
Drain the appliance according to the following steps:
1. Turn on the tap.
2. Open the door.
3. Switch on ON/OFF button (.
4. Select wash cycle with the highest temperature.
The estimated wash cycle duration is indicated on
the digital display @.
5. Press START button )*.
6. Close the door.
Wash cycle sequence starts.
7. Open the door after approx. 4 minutes.
8. Press START button )* until “Program was
terminated”/“Ready in one minute.” is indicated at
the digital display @.
9. Close the door.
10. Open the door after approx. 1 minute.
The digital display @ indicates; “Finished”.
11. Switch off ON/OFF switch (.
12. Turn off the tap, disconnect supply hose and drain
water.
Note: Transport appliance upright only. This prevents
residual water from running into the machine control
and damaging the wash cycle sequence.
Securing the appliance against frost
If the appliance is in a room where there is a risk of frost
(e.g. holiday home), empty the appliance completely
(see “Transporting the appliance”).
