
Write the model and serial
numbers here:
Model # _________________
Serial # _________________
You can find them on a label
behind the door or drawer.
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
OWNER’S MANUAL
RANGES
Electric Front Control
49-80815-1 06-18 GEA
SAFETY INFORMATION .......... 3
USING THE RANGE
Surface Units ........................... 7
Cookware for Radiant Glass Cooktop. . . . . .10
Oven Controls ..........................11
Special Features ........................12
Sabbath Mode ..........................13
Oven Racks ............................14
Aluminum Foil and Oven Liners ...........14
Cookware ..............................14
Cooking Modes .........................15
Cooking Guide .........................16
CARE AND CLEANING
Cleaning the Range – Exterior ............17
Cleaning the Range – Interior ............18
Cleaning the Glass Cooktop ..............19
Oven Light ............................20
Oven Door .............................21
Removable Storage Drawer ............. 22
TROUBLESHOOTING TIPS ....... 23
LIMITED WARRANTY ............ 26
ACCESSORIES .................... 27
CONSUMER SUPPORT ........... 28
JS760 - 30" Front Control Range
GE is a trademark of the General Electric Company. Manufactured under trademark license.

2 49-80815-1
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.

49-80815-1 3
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
SAFETY INFORMATION
ANTI-TIP DEVICE
To reduce the risk of tipping the range, the range must
be secured by a properly installed anti-tip bracket. See
installation instructions shipped with the bracket for
complete details before attempting to install.
For Free-Standing and Slide-In Ranges
To check if the bracket is installed and engaged
properly, look underneath the range to see that the
rear leveling leg is engaged in the bracket. On some
models, the storage drawer or kick panel can be
removed for easy inspection. If visual inspection is not
possible, slide the range forward, confirm the anti-tip
bracket is securely attached to the floor or wall, and
slide the range back so the rear leveling leg is under
the anti-tip bracket.
If your range is removed for cleaning, servicing or
any reason, be sure the anti-tip device is reengaged
properly when the range is replaced. Failure to take
this precaution could result in tipping of the range
and can result in death or serious burns to children or
adults.
Never completely remove the leveling legs or the
range will not be secured to the anti-tip device
properly.
WARNING
Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
• Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
Tip-Over Hazard
WARNING
Anti-Tip
Bracket
Leveling Leg
Free-Standing and Slide-In Ranges
WARNING
GENERAL SAFETY INSTRUCTIONS
■ Usethisapplianceonlyforitsintendedpurposeas
described in this Owner’s Manual.
■ Besureyourapplianceisproperlyinstalledand
grounded by a qualified installer in accordance with
the provided installation instructions.
■ Donotattempttorepairorreplaceanypartofyour
range unless it is specifically recommended in this
manual. All other servicing should be transferred to
a qualified technician.
■ Beforeperforminganyservice,unplugtherange
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
■ Donotleavechildrenalone—childrenshouldnot
be left alone or unattended in an area where an
appliance is in use. They should never be allowed
to climb, sit or stand on any part of the appliance.
■
CAUTION
Donotstoreitemsofinterestto
children above a range or on the backguard of a
range—childrenclimbingontherangetoreach
items could be seriously injured.
■ Useonlydrypotholders—moistordamppot
holders on hot surfaces may result in burns from
steam.Donotletpotholderstouchhotsurface
unitsorheatingelements.Donotuseatowelor
other bulky cloth in place of pot holders.
■ Neveruseyourapplianceforwarmingorheating
the room.
■ Donottouchthesurfaceunits,theheatingelements
or the interior surface of the oven. These surfaces
may be hot enough to burn even though they are
darkincolor.Duringandafteruse,donottouch,
or let clothing or other flammable materials contact
the surface units, areas nearby the surface units or
any interior area of the oven; allow sufficient time
for cooling first. Other surfaces of the appliance
may become hot enough to cause burns. Potentially
hot surfaces include the cooktop, areas facing the
cooktop, oven vent opening, surfaces near the
opening and crevices around the oven door.
■ Donotheatunopenedfoodcontainers.Pressure
could build up and the container could burst,
causing an injury.

4 49-80815-1
WARNING
KEEP FLAMMABLE MATERIALS AWAY FROM THE OVEN
Failure to do so may result in fire or personal injury.
■ Donotstoreoruseflammablematerialsinanoven
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
■ Neverwearloose-fittingorhanginggarmentswhile
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
■ Donotletcookinggreaseorotherflammable
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
WARNING
IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
■ Donotusewaterongreasefires.Neverpickup
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
tray.Useamulti-purposedrychemicalorfoam-type
fire extinguisher.
■ Ifthereisafireintheovenduringbaking,smother
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
■ Ifthereisafireintheovenduringself-clean,turn
the oven off and wait for the fire to go out. Donot
force the door open. Introduction of fresh air at self-
clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING
COOKTOP SAFETY INSTRUCTIONS
■ Neverleavethesurfaceunitsunattendedatmedium
or high heat settings. Boilovers cause smoking and
greasy spillovers that may ignite.
■ Neverleaveoilunattendedwhilefrying.Ifallowed
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
cabinets.Useadeepfatfryingthermometer
whenever possible to monitor oil temperature.
■ Toavoidoilspilloverandfire,useaminimum
amount of oil when shallow pan-frying and avoid
cooking frozen foods with excessive amounts of ice.
■ Useproperpansize—selectcookwarehaving
flat bottoms large enough to cover the surface
heating element. The use of undersized cookware
will expose a portion of the surface unit to direct
contact and may result in ignition of clothing. Proper
relationship of cookware to surface unit will also
improve efficiency.
WARNING
GENERAL SAFETY INSTRUCTIONS (Cont.)
■ Donotuseanytypeoffoilorlinertocoverthe
oven bottom or anywhere in the oven, except as
described in this manual. Oven liners can trap heat
or melt, resulting in damage to the product and risk
of shock, smoke or fire.
■ Avoidscratchingorimpactingglassdoors,cook
topsorcontrolpanels.Doingsomayleadtoglass
breakage.Donotcookonaproductwithbroken
glass. Shock, fire or cuts may occur. Contact a
qualified technician immediately
■ Cookfoodthoroughlytohelpprotectagainst
foodborne illness. Minimum safe food temperature
recommendations can be found at IsItDoneYet.gov
and fsis.usda.gov.Useafoodthermometertotake
food temperatures and check several locations.

49-80815-1 5
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING
COOKTOP SAFETY INSTRUCTIONS (Cont.)
■ Whenusingglass/ceramiccookware,makesureit
is suitable for cooktop service; others may break
because of sudden change in temperature.
■ Tominimizethepossibilityofburns,ignitionof
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby surface units.
■ Whenpreparingflamingfoodsunderahood,turn
the fan on.
■ Ifpowerislosttoanelectriccooktopwhilea
surface unit is ON, the surface unit will turn back on
as soon as power is restored. In the event of power
loss, failure to turn all surface unit knobs to the OFF
position may result in ignition of items on or near
the cooktop, leading to serious injury or death.
WARNING
RADIANT COOKTOP SAFETY INSTRUCTIONS
■ Usecarewhentouchingthecooktop.Theglass
surface of the cooktop will retain heat after the
controls have been turned off.
■ Donotcookonabrokencooktop.Ifglasscooktop
should break, cleaning solutions and spillovers
may penetrate the broken cooktop and create a
risk of electric shock. Contact a qualified technician
immediately.
■ Avoidscratchingtheglasscooktop.Thecooktop
can be scratched with items such as knives, sharp
instruments, rings or other jewelry, and rivets on
clothing.
■ Donotplaceorstoreitemsthatcanmeltorcatch
fire on the glass cooktop, even when it is not being
used. If the cooktop is inadvertently turned on, they
may ignite. Heat from the cooktop or oven vent after
it is turned off may cause them to ignite also.
■ UseCERAMABRYTE
®
ceramic Cooktop Cleaner
and CERAMA BRYTE
®
Cleaning Pad to clean
the cooktop. Wait until the cooktop cools and the
indicator light goes out before cleaning. A wet
sponge or cloth on a hot surface can cause steam
burns. Some cleaners can produce noxious fumes if
applied to a hot surface. NOTE: Sugar spills are an
exception. They should be scraped off while still hot
using an oven mitt and a scraper. See the Cleaning
the glass cooktop section for detailed instructions.
■ Readandfollowallinstructionsandwarningsonthe
cleaning cream label.
WARNING
OVEN SAFETY INSTRUCTIONS
■ Standawayfromtherangewhenopeningtheoven
door. Hot air or steam which escapes can cause
burnstohands,faceand/oreyes.
■ Donotusetheovenifaheatingelementdevelops
a glowing spot during use or shows other signs
of damage. A glowing spot indicates the heating
element may fail and present a potential burn, fire,
or shock hazard. Turn the oven off immediately and
have the heating element replaced by a qualified
service technician.
■ Keeptheovenventunobstructed.
■ Keeptheovenfreefromgreasebuildup.Greasein
the oven may ignite.
■ Placeovenracksindesiredlocationwhileovenis
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
■ Whenusingcookingorroastingbagsintheoven,
follow the manufacturer’s directions.
■ Pulltheovenracktothestop-lockpositionwhen
loading and unloading food from the oven. This
helps prevent burns from touching hot surfaces of
the door and oven walls.
■ Donotleaveitemssuchaspaper,cookingutensils
or food in the oven when not in use. Items stored in
an oven can ignite.
■ Neverplacecookingutensils,pizzaorbakingstones,
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.

6 49-80815-1
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface.Donotuseanysharpitemstoremovethefilm.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: All protective packing must be removed from all
parts. It cannot be removed if it is baked on.
STATE OF CALIFORNIA PROPOSITION 65 WARNINGS
WARNING
This product contains one or more chemicals known to the State of California to cause cancer,
and birth defects or other reproductive harm.
Self clean ovens can cause low level exposure to some of the Proposition 65 substances, including carbon
monoxide, during the cleaning cycle. Exposure to these substances can be minimized by opening a window or
using a ventilation fan or hood.
SAFETY INFORMATION
READ AND SAVE THESE INSTRUCTIONS
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING
SELF-CLEANING OVEN SAFETY INSTRUCTIONS
The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven.
Follow these instructions for safe operation.
■ Donottouchovensurfacesduringself-clean
operation.Keepchildrenawayfromtheovenduring
self-cleaning. Failure to follow these instructions
may cause burns.
■ Beforeoperatingtheself-cleancycle,removepans,
shiny metal oven racks and other utensils from the
oven. Only enameled (not shiny) oven racks may be
leftintheoven.Donotuseself-cleantocleanother
parts, such as drip pans or bowls.
■ Beforeoperatingtheself-cleancycle,wipegrease
and food soils from the oven. Excessive amount
of grease may ignite leading to smoke damage to
your home.
■ Iftheself-cleaningmodemalfunctions,turnthe
oven off and disconnect the power supply. Have it
serviced by a qualified technician.
■ Donotcleanthedoorgasket.Thedoorgasketis
essential for a good seal. Care should be taken not
to rub, damage or move the gasket.
■ Donotuseovencleaners.Nocommercialoven
cleaner or oven liner protective coating of any kind
should be used in or around any part of the oven.

49-80815-1 7
USING THE RANGE:SurfaceUnits
Surface Units
WARNING
FIRE HAZARD: Never leave the range unattended with the cooktop on medium or high settings.
Keepflammableitemsawayfromthecooktop.Turnoffallcontrolswhendonecooking.Failureto
follow these instructions can result in fire, serious injury or death.
Throughout this manual, features and appearance may vary from your model.
NOTE: Before using the cooktop for the first time, clean it with CERAMA BRYTE
®
Ceramic Cooktop Cleaner. This
helps protect the top and makes cleanup easier.
How to Set
Push the knob in and turn in either direction to the
setting you want.
A surface ON indicator light will glow when any surface
unit is on
For glass cooktop surfaces:
A HOT COOKTOP indicator light will:
■ comeonwhentheunitishottothetouch.
■ stayonevenaftertheunitisturnedoff.
■ stayonuntiltheunitiscooledto
approximately 150°F.
Dual Surface Units and Control Knobs (on some models)
The surface unit has 2 or 3 cooking sizes to select from so you can match the size of the unit to the size of the
cookware you are using.
At both OFF and HI the control clicks
into position. You may hear slight
clicking sounds during cooking,
indicating the control is maintaining
your desired setting.
Be sure you turn the control knob to
OFF when you finish cooking.
Melt setting (on some models)
will melt chocolate or butter.
ModelswithaDual-Ring
surface element only

8 49-80815-1
Surface Units (Cont.)
USING THE RANGE:SurfaceUnits
Using the Warming Zone
WARNING
FOOD POISON HAZARD: Bacteria may grow in food at
temperatures below 140°F.
■ Alwaysstartwithhotfood.Donotusewarmsettingto
heat cold food.
■ Donotusewarmsettingformorethan2hours.
The WARMING ZONE, located in the back center of
the glass surface, will keep hot, cooked food at serving
temperature.Alwaysstartwithhotfood.Donotuseto
heat cold food. Placing uncooked or cold food on the
WARMING ZONE could result in foodborne illness.
To turn the WARMING ZONE on, press Warming Zone
ON/OFF, select Lo, Med or Hi with the number pads, and
press Start.
To turn the WARMING ZONE off, press the Warming
Zone ON/OFF pad.
For best results, all foods on the WARMING ZONE
should be covered with a lid or aluminum foil. When
warming pastries or breads, the cover should be vented
to allow moisture to escape.
The initial temperature, type and amount of food, type of
pan, and the time held will affect the quality of the food.
Always use pot holders or oven mitts when removing
food from the WARMING ZONE, since cookware and
plates will be hot.
NOTE: The surface warmer will not glow red like the
cooking elements.
NOTE: TheCancel/Offpaddoesnotturnoffthe
Warming Zone

49-80815-1 9
Home Canning Tips
Be sure the canner is centered over the surface unit.
Make sure the canner is flat on the bottom.
To prevent burns from steam or heat, use caution when
canning.
Userecipesandproceduresfromreputablesources.
These are available from manufacturers such as Ball
®
andKerr
®
andtheDepartmentofAgricultureExtension
Service.
Flat-bottomedcannersarerecommended.Useofwater
bath canners with rippled bottoms may extend the time
required to bring the water to a boil.
Temperature Limiter on Radiant Glass Cooktops
Every radiant surface unit has a temperature limiter.
The temperature limiter protects the glass cooktop from
getting too hot.
The temperature limiter may cycle the surface units off
for a time if:
■ thepanboilsdry.
■ thepanbottomisnotflat.
■ thepanisoff-center.
■ thereisnopanontheunit.
Radiant Glass Cooktop
The radiant cooktop features heating units beneath a
smooth glass surface.
NOTE: A slight odor is normal when a new cooktop is
used for the first time. It is caused by the heating of new
parts and insulating materials and will disappear in a
short time.
NOTE: On models with light-colored glass cooktops, it is
normal for the cooking zones to change color when hot
or cooling down. This is temporary and will disappear as
the glass cools to room temperature.
The surface unit will cycle on and off to maintain your
selected control setting.
It is safe to place hot cookware on the glass surface
even when the cooktop is cool.
Even after the surface units are turned off, the glass
cooktop retains enough heat to continue cooking. To
avoid overcooking, remove pans from the surface units
when the food is cooked. Avoid placing anything on the
surface unit until it has cooled completely.
■ Waterstains(mineraldeposits)areremovableusing
the cleaning cream or full-strength white vinegar.
■ Useofwindowcleanermayleaveaniridescentfilmon
the cooktop. The cleaning cream will remove this film.
■ Don’tstoreheavyitemsabovethecooktop.Ifthey
drop onto the cooktop, they can cause damage.
■ Donotusethesurfaceasacuttingboard.
USING THE RANGE:SurfaceUnits
Surface Units (Cont.)
Never cook directly on the glass. Always
use cookware.
Always place the pan in the center of the
surface unit you are cooking on.
Donotslidecookwareacrossthecooktopbecause
itcanscratchtheglass—theglassisscratch-
resistant, not scratch proof.

10 49-80815-1
Cookware for Radiant Glass Cooktop
USING THE RANGE: Cookware for Radiant Glass Cooktop
The following information will help you choose cookware which will give good performance on glass cooktops.
NOTE: Follow all cookware manufacturer’s recommendations when using any type of cookware on the ceramic cooktop.
Recommended
Stainless Steel
Aluminum:
heavy weight recommended
Good conductivity. Aluminum residues
sometimes appear as scratches on the
cooktop but can be removed if cleaned
immediately. Because of its low melting
point, thin weight aluminum should not
be used.
Copper Bottom:
Copper may leave residues which can
appear as scratches. The residues can
be removed, as long as the cooktop
is cleaned immediately. However, do
not let these pots boil dry. Overheated
metal can bond to glass cooktops. An
overheated copper bottom pot will leave
a residue that will permanently stain the
cooktop if not removed immediately.
Enamel (painted) on Cast Iron:
recommended if bottom of pan is coated
Avoid/Not Recommended
Enamel (painted) on Steel:
Heating empty pans can cause
permanent damage to cooktop glass.
The enamel can melt and bond to the
ceramic cooktop.
Glass-ceramic:
Poor performance. Will scratch the
surface.
Stoneware:
Poor performance. May scratch the
surface.
Cast Iron:
notrecommended—unlessdesigned
specifically for glass cooktops
Poor conductivity and slow to absorb
heat. Will scratch the cooktop surface.
Check pans for flat bottoms by
using a straight edge.
Pans with rounded, curved,
ridged or warped bottoms are
not recommended.
For Best Results
■ Placeonlydrypansonthesurfaceelements.Donot
place lids on the surface elements, particularly wet lids.
Wet pans and lids may stick to the surface when cool.
■ Donotusewoksthathavesupportrings.Thistypeof
wok will not heat on glass surface elements.
■ Werecommendthatyouuseonlyaflat-bottomed
wok. They are available at your local retail store. The
bottom of the wok should have the same diameter as
the surface element to ensure proper contact.
■ Somespecialcookingproceduresrequirespecific
cookware such as pressure cookers or deep-fat
fryers. All cookware must have flat bottoms and be
the correct size.
Donotplacewetpansontheglasscooktop.
Donotusewokswithsupportringsontheglasscooktop.
Useflat-bottomedwoksontheglasscooktop.

49-80815-1 11
1. Convection Cooking (on some models):
Convection cooking modes use increased air
circulation to improve performance. See the Cooking
Modes section for more information.
2. Traditional Cooking Modes: Your oven has
the following traditional cooking modes: Bake and
BroilHi/Lo.SeetheCookingModessectionformore
information.
3. Clean: Your oven has two cleaning modes: Self Clean
and Steam Clean. See the Cleaning the Oven section
for important information about using these modes.
4. Start: Must be pressed to start any cooking,
cleaning, or timed function.
5. Cancel/Off: Cancels ALL oven operations except
the clock and timer.
6. Number Pad
7. Warming Zone: The Warming Zone, located in
the back center of the glass surface, will keep hot,
cooked food at serving temperatures. Always start
withhotfood.Donotusetoheatcoldfood.Placing
uncooked or cold food on the Warming Zone could
result in foodborne illness. See Warming Zone section
for more information.
8. Cook Time: Counts down cooking time and turns
off the oven when the cooking time is complete. Press
the Cook Time pad, use the number pads to program
a cooking time in hours and minutes, then press Start.
This can only be used with Bake, Convection Bake,
and Convection Roast (where available).
9. Clock: Sets the oven clock time. Press the Set
Clock pad twice and the number pads to program the
clock. Press Start to save the time.
10. Timer: Works as a countdown timer. Press the Timer
pad and the number pads to program the time in hours
and minutes. Press the Start pad. The timer countdown
is complete. To turn the timer off press the Timer pad.
11. Delay Time:Delayswhentheovenwillturnon.
Usethistosetatimewhenyouwanttheoventostart.
Press the Delay Time pad and use the number pads
to program the time of day for the oven to turn on
then press Start. Press the desired cooking mode and
temperature then press Start. A Cook Time may also
be programmed if desired. Follow the directions under
Cook Time for setting this feature. This can only be
used with Bake, Convection Bake and Self-Clean.
NOTE: WhenusingtheDelayTimefeature, foods that
spoileasily—suchasmilk,eggs,fish,stuffings,poultry
andpork—shouldnotbeallowedtositformorethan
1 hour before or after cooking. Room temperature
promotes the growth of harmful bacteria. Be sure that
the oven light is off because heat from the bulb will
speed harmful bacteria growth.
12. Oven Light: Turns the oven light on or off.
13. Lock Controls: Locks out the control so that
pressing the pads does not activate the controls. Press
and hold the number pads or the Lock Controls pad,
for three seconds to lock or unlock the control. Cancel/
Off is always active, even when the control is locked.
14. Warm: Warm mode is designed to keep hot foods
hot for up to 3 hours. To use this mode, select WARM
and then START. Cover foods that need to remain
moist and do not cover foods that should be crisp.
Preheatingisnotrequired.Donotusewarmtoheat
cold food other than crisping crackers, chips or dry
cereal. It is also recommended that food not be kept
warm for more than 2 hours.
USING THE RANGE: Oven Controls
Oven Controls
2
14 10
345
12
7
1 8
1113
6 9

12 49-80815-1
Special Features
USING THE RANGE: Special Features
There are several different special features on your range.
■ ToentertheSpecialFeaturesmenu,presstheBake and Broil pads at the same time and hold for three
seconds. "OFFSEt" will appear in the display.
■ ScrollthroughSpecialFeaturesmenuusingthe8 pad for down and the 3 pad for up.
■ Toselectafeaturetochange,ortoconfirmachange,pressthe0 pad.
■ TocancelachangeandreturntotheSpecialFeaturesmenu,pressthe6 pad. To exit the Special Features
menu, press the 6 pad again.
Adjust the Oven Temperature (OFFSEt)
This feature allows the oven baking and convection
baking temperature to be adjusted up to 35ºF hotter
ordownto35ºFcooler.Usethisfeatureifyoubelieve
your oven temperature is too hot or too cold and wish to
change it. This adjustment affects Bake and Convection
Bake modes. No other cooking modes are affected.
Usingthenumberpadstonavigateasdescribedabove,
select "OFFSEt". A number between positive and
negative35willdisplay.Usethe8 or 3 pads to increase
or decrease the offset value. Save and confirm by
pressing the 0 pad.
Sound Volume (Sound)
This feature allows the oven tone volume to be adjusted
between high (Hi), medium (rEg), low (Lo), and off
(OFF). The control will sound the oven tone at the new
volume level each time the sound level is changed.
End of Timer Signals (End tonE)
This is the tone that signals the end of a timer. The tone
can be continuous (Cont) or one repeating beep (bEEP).
A continuous setting will continue to sound a tone until a
button on the control is pressed.
12-hour Shutoff (2H ShutoFF)
This feature shuts the oven down after 12 hours of
continuous operation. It may be enabled or disabled.
Fahrenheit or Celsius Temperature
Display (dEg Unit)
The oven control is set to use Fahrenheit temperatures
(F), but you can change it to use Celsius temperatures (C).
Clock Display (Cloc diSP)
This feature specifies whether the clock appears in the
display. It may be On or Off.
Clock Configuration (Cloc cFg)
This feature specifies how the time of day will be
displayed. You can select a standard 12-hour clock
(12) or 24-hour military time (24).
Auto Recipe Conversion (Auto rEciPE)
When using Convection Bake cooking, Auto Recipe
Conversion will automatically convert the regular baking
temperatures entered to convection bake cooking
temperatures when turned on. Note that this option does
not convert convection bake cooking times, it only converts
temperatures. This feature may be turned On or Off.

49-80815-1 13
Sabbath Mode
USING THE OVEN: Sabbath Mode
TheSabbathmodefeaturecomplieswithstandardssetforthbyStarK.Someofthesestandardsthatwillbenoticed
by the consumer include the disabling of tones, disabling of oven lights, and delays of about 30 seconds to one
minute on display changes. Only continuous baking or timed baking is allowed in the Sabbath mode. Cooking in the
Sabbath mode is a two-step process, first the Sabbath mode must be set and then the bake mode must be set.
Setting the Sabbath Mode
1. Press the Bake and Broil pads at the same time and
hold until the special features menu is displayed.
2. Usethe3 or 8 number pads to scroll through the
special features until “SAbbAth” is displayed and then
press 0. Refer to the graphic in the Special Features
section to see how the number keys are mapped.
3. Usethe3 or 8 number pads to scroll through the
options until “On” is shown in the display, then press
the 0 number pad to save the setting. Press 6 to exit
the Special Features menu. A single bracket “]” will
appear in the display indicating that the Sabbath mode
is set. The clock will not be displayed. Continuous
bake or timed bake can now be programmed.
Starting a Continuous Bake
1. Press the Bake pad.
2. If the desired temperature is 350F, press Start. If
a different cooking temperature is desired, use the
1 through 5 number pads or Timer pad to select a
preset cooking temperature, then press Start. Refer
to the graphic below to determine which pad sets the
desired cooking temperature.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking.
Adjusting the Temperature
1. Press Bake, use the 1 through 5 number pads and
the Timer pad to select a different preset cooking
temperature, and press Start.
2. Since no feedback is given during temperature
change, an oven thermometer can be used to confirm
temperature changes.
Starting a Timed Bake
1. Press the Bake pad.
2. If the desired temperature is 350F, use the 6 through
0 number pads or the Lock Control pad to select
a cooking time. If a cooking temperature other
than 350F is desired, use the 1 through 5 number
pads or the Timer pad to select a preset cooking
temperature, then select the cooking time. Refer to
the graphic on this page to determine which pad sets
the desired cooking temperature and cooking time.
3. Press Start.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking. When the cook
time expires, the display will change back to a single
bracket “]” indicating that the oven is no longer baking.
No tone will sound when the cook time is complete.
Exit the Sabbath Mode
Exiting the Sabbath mode should be done after the
Sabbath is over.
1. Press Cancel/Off to end any bake mode that may be
running.
2. Press Bake and Broil pads at the same time and
hold until the Special Features menu is displayed.
3. Usethe3 or 8 number pads to scroll through the
special features until “SAbbAth” is displayed, then
press 0.
4. Usethe3 or 8 number pads to scroll through the
options until “OFF” is displayed and press 0 to save
the setting. Press the 6 number pad to exit the
Special Features menu.
Sabbath Mode Power Outage Note
If a power outage occurs while the oven is in Sabbath
Mode, the unit will return to Sabbath Mode when power
isrestored,howevertheovenwillreturntotheostate
even if it was in the middle of a bake cycle when the
power outage occurred.
1 = 170° F, 2 = 200° F, 3 = 250° F, 4 = 300° F, 5 = 325° F, Timer = 400° F
6 = 2 hours, 7 = 2.5 hours, 8 = 3 hours, 9 = 3.5 hours,
0 = 4 hours, Lock Controls = 6 hours
Temperature (°F) 400
Time (hours)
6h
170
2h
200
2.5h
250
3h
300
3.5h
325
4h

14 49-80815-1
Recommended rack positions for various types of
foods are provided in the Cooking Guide. Adjusting
rack position is one way to impact cooking results. For
example, if you would prefer darker tops on cakes,
muffins, or cookies, try moving food one rack position
higher. If you find foods are too brown on top try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is at least 1½" between pans to allow
sufficient space for air to flow.
To avoid possible burns, place the racks in the desired
position before you turn the oven on.
USING THE RANGE:OvenRacks/AluminumFoilandOvenLiners/Cookware
Oven Racks
Cookware
Cookware Guidelines
The material, finish, and size of cookware affect baking
performance.
Dark,coatedanddullpansabsorbheatmorereadily
than light, shiny pans. Pans that absorb heat more
readily can result in a browner, crisper, and thicker crust.
If using dark and coated cookware check food earlier
than minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
oven temperature by 25º F next time.
Shiny pans can produce more evenly cooked baked
goods such as cakes and cookies.
Glass and ceramic pans heat slowly but retain heat well.
These types of pans work well for dishes such as pies
and custards.
Air insulated pans heat slowly and can reduce bottom
browning.
Keepcookwarecleantopromoteevenheating.
CAUTION
Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foilmaybeusedtocatchspillsbyplacingasheetonalowerrack,severalinchesbelowthefood.Donotusemore
foilthannecessaryandneverentirelycoveranovenrackwithaluminumfoil.Keepfoilatleast1-1/2”fromovenwalls
to prevent poor heat circulation.
Aluminum Foil and Oven Liners
The number of rack positions may vary by model.

49-80815-1 15
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for recommendations for specific foods. Remember, your new oven may perform
differently than the oven it is replacing. NOTE: Remove unused racks when using the oven for faster preheat,
improved efficiency and optimal performance.
Baking and Roasting Modes
Select a mode for baking and roasting based on the
type and quantity of food you are preparing. When
preparing baked goods such as cakes, cookies, and
pastries always preheat the oven first. Follow recipe
recommendations for food placement. If no guidelines
are provided, center food in the oven.
Traditional Bake
The traditional bake mode is intended for single rack
cooking. This mode uses heat primarily from the lower
element but also from the upper element to cook
food. To use this mode press the Bake pad, enter
a temperature, and then press Start. Preheating is
generally recommended when using this mode.
Convection Bake
The Convection Bake mode is intended for baking
on multiple racks at the same time. This mode uses
heat from the upper and lower elements, along with
air movement from the convection fan to enhance
cooking evenness. Your oven is equipped with Auto
Recipe Conversion, so it is not necessary to convert the
temperature when using this mode. Baking time might
be slightly longer for multiple racks than what would be
expected for a single rack. To use this mode press the
Convection Bake pad, enter a temperature, and then
press Start. Always preheat when using this mode.
Convection Roast
The Convection Roast mode is intended for roasting
whole cuts of meat on a single rack. This mode uses
heat from the lower, upper, and rear elements along
with air movement from the convection fan to improve
browning and reduce cooking time. It is not necessary to
convert temperature. Check food earlier than the recipe
suggested time when using this mode or use a meat
probe. To use this mode press the Convection Roast
pad, enter a temperature, and then press Start. It is not
necessary to preheat when using this mode.
Broiling Modes
Always broil with the door closed. Monitor food closely
whilebroiling.Usecautionwhenbroilingonupperrack
positions as placing food closer to the broil element
increases smoking, spattering, and the possibility of fats
igniting. For best performance center food below the broil
heating element. Broiling on rack position 7 is not
recommended.
Try broiling foods that you would normally grill. Adjust
rack positions to adjust the intensity of the heat to the
food. Place foods closer to the broil element when a
seared surface and rare interior is desired. Thicker foods
and foods that need to be cooked through should be
broiled on a rack position farther from the broiler or by
using Broil Lo.
Broil Hi
The Broil Hi mode uses intense heat from the upper
elementtosearfoods.UseBroilHiforthinnercutsof
meatand/orfoodsyoupreferlessdoneontheinterior.
To use this mode press the Broil pad once and then
press Start. It is not necessary to preheat when using
this mode.
Broil Lo
The Broil Lo mode uses less intense heat from the upper
element to cook food thoroughly while also producing
surfacebrowning.UseBroilLoforthickercutsofmeat
and/orfoodsthatyouwouldlikecookedalltheway
through. To use this mode press the Broil pad twice and
then press Start. It is not necessary to preheat when
using this mode.
Warm
To use this mode, press the Warm pad then press Start.
Cover foods that need to remain moist and do not cover
foods that should be crisp. Preheating is not required.
Donotusewarmtoheatcoldfoodotherthancrisping
crackers, chips or dry cereal. It is also recommended
that food not be kept warm for more than 2 hours.
Cooking Modes
USING THE RANGE: Cooking Modes

16 49-80815-1
FOOD TYPE
RECOMMENDED
MODE(S)
RECOMMENDED
RACK POSITION(S) ADDITIONAL SUGGESTIONS
Baked Goods
Layer Cakes, sheet cakes,
bundt cakes, muffins, quick
breads on a Single Rack
Bake 3 Useshinycookware.
Layer cakes* on Multiple
Racks
Bake
Convection Bake
2 and 4
Useshinycookware.Ensureadequateairflow
(see illustration below).
Chiffon cakes (angel food) Bake 1 Useshinycookware.
Cookies, biscuits, scones on
a Single Rack
Bake 3 Useshinycookware.
Cookies, biscuits, scones on
Multiple Racks
Convection Bake 2 and 4 Useshinycookware.Ensureadequateairflow.
Beef & Pork
Hamburgers Broil Hi 6
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heater.
Steaks & Chops Broil Hi 5 or 6
Useabroilpan;movefooddownformoredoneness/
less searing. Watch food closely when broiling. For best
performance center food below the broil heater.
Roasts
Bake
Convection Roast
2 or 3
Usealowsidedpansuchasabroilpan.Preheatingisnot
necessary.
Poultry
Whole chicken
Bake
Convection Roast
2 or 3
Usealowsidedpansuchasabroilpan.
Preheating is not necessary.
Bone-in chicken breasts,
legs, thighs
Broil Lo
Bake
3
If breaded or coated in sauce avoid Broil Hi modes. Broil skin
side down first. Watch food closely when broiling. For best
performance when broiling, center food below the broil heater.
Boneless chicken breasts
Broil Lo
Bake
3
If breaded or coated in sauce avoid Broil Hi modes. Broil skin
side down first. Watch food closely when broiling. For best
performance when broiling, center food below the broil heater.
Whole turkey
Bake
Convection Roast
1
Usealowsidedpansuchasabroilpan.
Preheating is not necessary.
Turkey Breast
Bake
Convection Roast
3
Usealowsidedpansuchasabroilpan.
Preheating is not necessary.
Fish Broil Lo
6(1/2thickorless)
5(>1/2inch)
Watch food closely when broiling. For best performance center
food below the broil heater.
Casseroles Bake 3 or 4
Frozen Convenience Foods
Pizza, potato products,
chicken nuggets, appetizers
on a Single Rack
Bake 3
Usedarkcookwareformorebrowning/crisping;
use shiny cookware for less browning.
Pizza, potato products,
chicken nuggets, appetizers
on Multiple Racks
Convection Bake 2 and 4
Useshinycookware.Staggerpizzaslefttoright,donotplace
directly over each other.
*When baking four cake layers at a time, use racks 2
and 4. Place the pans as shown so that one pan is not
directly above another.
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
IsItDoneYet.gov. Make sure to use a food thermometer
to take food temperatures.
USING THE RANGE: Cooking Guide
Cooking Guide
Rear Placement
Front Placement
Rack positions

49-80815-1 17
A child or adult can tip the range and be killed.
Verify the anti-tip bracket has been properly installed
and engaged.
Ensure the anti-tip bracket is re-engaged when the range
is moved.
Do not operate the range without the anti-tip bracket in
place and engaged.
Failure to follow these instructions can result in death or
serious burns to children or adults.
Tip-Over Hazard
WARNING
Cleaning the Range – Exterior
CARE AND CLEANING: Cleaning the Range – Exterior
WARNING
If your range is removed for cleaning, servicing or any reason, be sure the
anti-tip device is reengaged properly when the range is replaced. Failure to
take this precaution could result in tipping of the range and can result in death
or serious burns to children or adults.
Be sure all controls are off and all surfaces are cool before cleaning any part of the range.
Control Knobs
The control knobs may be removed for easier cleaning.
Make sure the knobs are in the OFF positions and pull
them straight off the stems for cleaning.
The knobs can be cleaned in a dishwasher or they may
also be washed with soap and water. Make sure the
inside of the knobs are dry before replacing.
Replace the knobs, in the OFF position to ensure proper
placement.
Control Lockout
If desired, the touch pads may be deactivated before
cleaning.
See Lock Controls in the Oven Controls section in this
manual.
Clean up splatters with a damp cloth.
Removeheaviersoilwithwarm,soapywater.Donotuse
abrasives of any kind.
Reactivate the touch pads after cleaning.
Control Panel
It’s a good idea to wipe the control panel after each use.
Clean with mild soap and water or vinegar and water,
rinse with clean water and polish dry with a soft cloth.
Donotuseabrasivecleansers,strongliquidcleansers,
plastic scouring pads or oven cleaners on the control
panel - they will damage the finish, including Black
Stainless Steel.
Oven Exterior
Donotuseovencleaners,abrasivecleansers,strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the interior or exterior of the oven.
Clean with a mild soap and water or vinegar and water
solution. Rinse with clean water and dry with a soft cloth.
When cleaning surfaces, make sure that they are at
room temperature and not in direct sunlight.
If stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up immediately. Let hot surfaces
cool, then clean and rinse.
Painted Surfaces and Black Stainless Steel
Painted surfaces include the sides of the range and the
door, top of control panel, maintop trims and the drawer
front. Clean these with soap and water or a vinegar and
water solution.
Donotusecommercialovencleaners,cleaning
powders, steel wool or harsh abrasives on any painted
surface, including Black Stainless Steel.
Stainless Steel - Excluding Black Stainless Steel (on some models)
Donotuseasteelwoolpad;itwillscratchthesurface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish read the
Assistance and Accessories sections at the beginning of
this manual.

18 49-80815-1
Be sure all controls are off and all surfaces are cool before cleaning any part of the range. The interior of your new
oven can be cleaned manually or by using Steam Clean or Self Clean modes.
Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and
should be wiped up immediately. Let hot surfaces cool, then clean and rinse.
Manual Cleaning
Donotuseovencleaners,abrasivecleaners,strong
liquid cleansers, steel wool, scouring pads, or cleaning
powders on the interior of the oven. Clean with a mild
soap and water or vinegar and water solution. Rinse with
clean water and dry with a soft cloth. When cleaning
surfaces, make sure that they are at room temperature.
Steam Clean Mode
Steam clean is intended to clean light soils using water
and a lower cleaning temperature than Self-Clean.
To use the Steam Clean feature, wipe grease and soils
from the oven. Pour one cup of water into the bottom of
the oven. Close the door. Press the Steam Clean pad
and then press Start. The door will lock. You can not
open the door during the 30 minute steam clean as this
will decrease the steam clean performance. When the
cycle completes, soak up remaining water and wipe the
oven walls and door.
Self Clean Mode
Read Self-Cleaning Oven Safety Instructions at the
beginning of this manual before using Self Clean Mode.
Self clean uses very high temperatures to clean the oven
interior. The oven door will lock when using this feature.
Before operating the self-clean cycle, wipe up grease
and soils from the oven. Remove all items from the oven
other than enameled (dark color) racks. Shiny or silver
racks, the meat probe, and any cookware or other items
should all be removed from the oven before initiating a
self-clean cycle. Close the door. Press the Self Clean
pad and a default self-clean time is displayed. The clean
time can be changed to any time between 3:00 and
5:00 hours by using the number pads to enter a different
time and pressing Start. For heavily soiled ovens, the
maximum 5 hour clean time is recommended. If you wish
to use the default time, press the Start pad immediately
after pressing the Clean pad. The oven will turn off
automatically when the self-clean cycle is complete. The
door will stay locked until the oven has cooled down. After
the oven has cooled down wipe any ash out of the oven.
We recommend venting your kitchen with an open
window or using a ventilation fan or hood during the first
self-clean cycle.
Soil on the front frame of the range and outside the
gasket on the door will need to be cleaned by hand.
Clean these areas with hot water, soap-filled steel-wool
pads or cleansers such as Soft Scrub
®
. Rinse well with
clean water and dry.
Donotcleanthegasket.Thefiberglassmaterialof
the oven door gasket cannot withstand abrasion. It is
essential for the gasket to remain intact. If you notice it
becoming worn or frayed, replace it.
Make sure the oven light bulb cover is in place and the
oven light is off.
IMPORTANT: The health of some birds is extremely
sensitive to the fumes given off during the self-cleaning cycle
of any range. Move birds to another well-ventilated room.
On Some Models:
The surface units are automatically disabled during the
self-clean cycle. Make sure that all surface unit controls
are turned off at all times during the self-clean cycle.
Any surface unit that is set to an “on” position while the
self-clean cycle is operating will automatically come on
after the self-clean cycle is finished, and could result in
an “on” unattended surface unit. Wait until the self-clean
cycle is finished to set and use the surface units.
Cleaning the Range – Interior
Racks
All racks can be washed with warm, soapy water.
Enameled (not shiny) racks can be left in the cavity
during self clean.
Racks may be more difficult to slide, especially after
a self-clean. Put some vegetable oil on a soft cloth or
paper towel and rub onto the left and right edges.
Oven Heating Elements
Donotcleanthebakeelementorthebroilelement.Any
soil will burn off when the elements are heated.
To clean the oven floor when the bake element is
exposed, gently lift the bake element. On some models,
the bake element is not exposed and is under the oven
floor. Clean the oven floor with warm, soapy water.
Wipe up heavy soil on the oven bottom.
Gently lift the bake element
CARE AND CLEANING: Cleaning the Range – Interior

49-80815-1 19
CARE AND CLEANING: Cleaning the Glass Cooktop
Normal Daily Use Cleaning
ONLY use CERAMA BRYTE
®
Ceramic Cooktop
Cleaner on the glass cooktop. Other creams may not
be as effective.
To maintain and protect the surface of your glass cooktop,
follow these steps:
1. Before using the cooktop for the first time, clean it
with CERAMA BRYTE
®
Ceramic Cooktop Cleaner.
This helps protect the top and makes cleanup easier.
2. DailyuseofCERAMABRYTE
®
Ceramic Cooktop
Cleaner will help keep the cooktop looking new.
3. Shake the cleaning cream well. Apply a few drops of
CERAMA BRYTE
®
Ceramic Cooktop Cleaner directly
to the cooktop.
4. Useapapertowelor
CERAMA BRYTE
®
Cleaning
Pad for Ceramic Cooktops
to clean the entire cooktop
surface.
5. Useadryclothorpaper
towel to remove all cleaning
residue. No need to rinse.
6. DonotuseCeramabryteon
any metal parts located next
to the glass.
NOTE: It is very important that
youDONOTheatthecooktop
until it has been cleaned thoroughly.
Burned-On Residue
NOTE:DAMAGEtoyourglasssurfacemayoccurifyou
use scrub pads other than those recommended.
1. Allow the cooktop to cool.
2. Spread a few drops of CERAMA BRYTE
®
Ceramic
Cooktop Cleaner on the entire burned residue area.
3. UsingtheincludedCERAMABRYTE
®
Cleaning Pad
for Ceramic Cooktops, rub the residue area, applying
pressure as needed.
4. If any residue remains, repeat the steps listed above
as needed.
5. For additional protection, after all residue has been
removed, polish the entire surface with CERAMA
BRYTE
®
Ceramic Cooktop Cleaner and a paper towel.
Heavy, Burned-On Residue
1. Allow the cooktop to cool.
2. Useasingle-edgerazorbladescraperatapproximately
a 45° angle against the glass surface and scrape the
soil. It will be necessary to apply pressure to the razor
scraper in order to remove the residue.
3. After scraping with the razor scraper, spread a few drops
of CERAMA BRYTE
®
Ceramic Cooktop Cleaner on the
entireburnedresiduearea.UsetheCERAMABRYTE
®
Cleaning Pad to remove any remaining residue.
4. For additional protection, after all residue has been
removed, polish the entire surface with CERAMA
BRYTE
®
Ceramic Cooktop Cleaner and a paper towel.
Clean your cooktop after each
spill.UseCERAMABRYTE
®
Ceramic Cooktop Cleaner.
The CERAMA BRYTE
®
Ceramic Cooktop Scraper and all
recommended supplies are available through our Parts Center.
Seeinstructionsunder“Assistance/Accessories”section.
NOTE:Donotuseadullornickedblade.
Cleaning the Glass Cooktop
UseaCERAMABRYTE
®
Cleaning
Pad for Ceramic Cooktops.
Metal Marks and Scratches`
1. Be careful not to slide pots and pans across your
cooktop. It will leave metal markings on the cooktop
surface.
These marks are removable using the CERAMA
BRYTE
®
Ceramic Cooktop Cleaner with the CERAMA
BRYTE
®
Cleaning Pad for Ceramic Cooktops.
2. If pots with a thin overlay of aluminum or copper
are allowed to boil dry, the overlay may leave black
discoloration on the cooktop.
This should be removed immediately before heating
again or the discoloration may be permanent.
NOTE: Carefully check the bottom of pans for roughness
that would scratch the cooktop.

20 49-80815-1
Oven Light Replacement (on some models)
To remove:
1.Turntheglasscovercounterclockwise1/4turnuntil
the tabs of the glass cover clear the grooves of the
socket. Wearing latex gloves may offer a better grip.
2.Usingglovesoradrycloth,removethebulbbypulling
it straight out.
To replace:
1.Useanew120/130-volthalogenbulb,nottoexceed
50 watts. Replace the bulb with the same type of bulb
that was removed. Be sure the replacement bulb is
rated 120 volts or 130 volts (NOT 12 volts).
2.Usingglovesoradrycloth,removethebulbfromits
packaging.Donottouchthebulbwithbarefingers.Oil
from skin will damage the bulb and shorten its life.
3. Push the bulb straight into the receptacle all the way.
4. Place the tabs of the glass cover into the grooves of
thesocket.Turntheglasscoverclockwise1/4turn.
For improved lighting inside the oven, clean the glass
cover frequently using a wet cloth. This should be
done when the oven is completely cool.
5. Reconnect electrical power to the oven.
Damage from Sugary Spills and Melted Plastic
Special care should be taken when removing hot substances to avoid permanent damage of the glass surface.
Sugary spillovers (such as jellies, fudge, candy, syrups) or melted plastics can cause pitting of the surface of your
cooktop (not covered by the warranty) unless the spill is removed while still hot. Special care should be taken when
removing hot substances.
Be sure to use a new, sharp razor scraper.
Donotuseadullornickedblade.
1. Turn off all surface units. Remove hot pans.
2. Wearing an oven mitt:
a. Useasingle-edgerazorbladescrapertomove
the spill to a cool area on the cooktop.
b. Remove the spill with paper towels.
3. Any remaining spillover should be left until the surface
of the cooktop has cooled.
4.Don’tusethesurfaceunitsagainuntilallofthe
residue has been completely removed.
NOTE: If pitting or indentation in the glass surface has
already occurred, the cooktop glass will have to be
replaced. In this case, service will be necessary.
Cooktop Seal
To clean the cooktop seal around the edges of the glass,
lay a wet cloth on it for a few minutes, then wipe clean
with nonabrasive cleaners.
Cleaning the Glass Cooktop (Cont.)
WARNING
SHOCK OR BURN HAZARD: Before replacing oven light bulb, disconnect the electrical power to the
range at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn.
CAUTION
BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with
bare hands or a damp cloth can cause burns.
CARE AND CLEANING:CleaningtheGlassCooktop/OverLight
Oven Light
Usegloves
or cloth
Receptacle
G9 Bulb
Socket
Tab
Glass cover
Receptacle
(on some models)

49-80815-1 21
CARE AND CLEANING:OvenLight/OvenDoor
Oven Light Replacement (on some models)
To remove:
1. Turntheglasscovercounterclockwise1/4turnuntil
the tabs of the glass cover clear the grooves of the
socket. Wearing latex gloves may offer a better grip.
2. Remove the bulb by turning it counter-clockwise.
To replace:
1. Replace bulb with a new 40-watt appliance bulb.
Insert the bulb and turn it clockwise until it is tight.
2. Place the tabs of the glass cover into the grooves of
thesocket.Turntheglasscoverclockwise1/4turn.
For improved lighting inside the oven, clean the glass
cover frequently using a wet cloth. This should be
done when the oven is completely cool.
3. Reconnect electrical power to the oven.
Oven Light (Cont.)
The door is very heavy. Be careful when removing and lifting the door.
Donotliftthedoorbythehandle.
To remove the door:
1. Fully open the door.
2. Pull the hinge locks down toward the door frame, to
the unlocked position. A tool, such as a small flat-
blade screwdriver, may be required.
3. Firmly grasp both sides of the door at the top.
4. Close door to the door removal position. The door
should be open approximately 3" with no obstruction
above the door.
5. Lift door up and out until both hinge arms are clear of
the slots.
To replace the door:
1. Firmly grasp both sides of the door at the top.
2. Starting on the left side, with the door at the same
angle as the removal position, seat the indentation of
the hinge arm into the bottom edge of the hinge slot.
The notch in the hinge arm must be fully seated into
the bottom of the slot. Repeat for right side.
3. Fully open the door. If the door will not fully open, the
indentation is not seated correctly in the bottom edge
of the slot.
4. Push the hinge locks up against the front frame of the
oven cavity, to the locked position.
5. Close the oven door.
Removal position
Hinge lock
Slot
Pull hinge locks down to unlock
Push hinge locks up to lock
Hinge
lock
Hinge
arm
Indentation
Bottom
edge of
slot
Hinge arm
Oven Door

22 49-80815-1
Removable Storage Drawer
CARE AND CLEANING:RemovableStorageDrawer
Thestoragedrawerisagoodplacetostorecookwareandbakeware.Donotstoreplasticsorflammablematerialin
the drawer.
The storage drawer may be removed for cleaning under the range. Clean the storage drawer with a damp cloth or
sponge. Never use harsh abrasives or scouring pads.
Removing the Storage Drawer:
1. Pull drawer straight out until it stops.
2. Continue to pull the drawer until it is detached from
the oven.
Replacing the Storage Drawer:
1. Rest the left drawer rail inside the inner left rail guide
channel at the bottom and slide it in slightly.
2. Place the right drawer rail inside the inner right rail
guide channel at the top and slide it in slightly.
3. Keepthedrawerstraight(noneedtotilt)andslidethe
drawer all the way in.
Right drawer
rail guide
Left drawer
rail guide
Left drawer rail
Drawerrail
Drawerrailinchannel
Rail channel (Make
sure rail is completely
in the channel before
sliding drawer in
slightly.)
Right drawer rail
Drawerrail
Drawerrail
in channel
Rail channel (Make sure
rail is completely in the
channel before sliding
drawer in slightly.)

49-80815-1 23
TROUBLESHOOTING TIPS
Troubleshooting Tips ... Before you call for service
Save time and money! Review the charts on the following pages first and you may not need to call for service.
Problem Possible Cause What To Do
Surface units will not
maintain a rolling boil or
cooking is not fast enough
Improper cookware being used. Usepanswhichareflatandmatchthediameterofthe
surface unit selected.
In some areas, the power (voltage) may be low. Cover pan with a lid until desired heat is obtained.
Surface units do not work
properly
A fuse in your home may be blown or the circuit
breaker tripped.
Replace the fuse or reset the circuit breaker.
Cooktop controls improperly set. Check to see the correct control is set for the surface unit
you are using.
Surface unit stops glowing
when turned to a lower
setting
The unit is still on and hot. This is normal.
Scratches (may appear as
cracks) on cooktop glass
surface
Incorrect cleaning methods being used. Scratches are not removable. Tiny scratches will become
less visible in time as a result of cleaning.
Cookware with rough bottoms being used or coarse
particles (salt or sand) were between the cookware
and the surface of the cooktop. Cookware has been
slid across the cooktop surface.
To avoid scratches, use the recommended cleaning
procedures. Make sure bottoms of cookware are clean
before use, and use cookware with smooth bottoms.
Areas of discoloration on
the cooktop
Food spillovers not cleaned before next use. See the Cleaning the glass cooktop section.
Hot surface on a model with a light-colored
cooktop.
This is normal. The surface may appear discolored when
it is hot. This is temporary and will disappear as the glass
cools.
Plastic melted to the
surface
Hot cooktop came into contact with plastic placed
on the hot cooktop.
See the Cleaning the glass cooktop section as there is
potential for permanent damage without proper care.
Pitting (or indentation) of
the cooktop
Hot sugar mixture spilled on the cooktop. Call a qualified technician for replacement.
Frequent cycling off and
on of surface units
Improper cookware being used. Useonlyflatcookwaretominimizecycling.
My new oven doesn't
cook like my old one. Is
something wrong with the
temperature settings?
Your new oven has a different cooking system
from your old oven and therefore may cook
differently than your old oven.
For the first few uses, follow your recipe times and
temperatures carefully. If you still think your new oven
is too hot or too cold, you can adjust the temperature
yourself by following the steps in Special Features to meet
your specific cooking preference. NOTE: This adjustment
affects Bake and Convection Bake temperatures; it will not
affect Convection Roast, Broil or Clean.
Food does not bake
properly
Oven controls improperly set. See the Cooking Modes section.
Rack position is incorrect or rack is not level. See the Cooking Modes section and Cooking Guide.
Incorrect cookware or cookware of improper size
being used.
See the Cookware section.
Oven temperature needs adjustment. See the Special Features section.
Ingredient substitution Substituting ingredients can change the recipe outcome.
Food does not broil
properly
Oven controls improperly set. Make sure you select the appropriate broil mode.
Improper rack position being used. See Cooking Guide for rack location suggestions.
Food being cooked in a hot pan. Make sure cookware is cool.
Cookware not suited for broiling. Useapanspecificallydesignedforbroiling.
Aluminum foil used on the broiling pan and
grid has not been fitted properly and slit as
recommended.
If using aluminum foil conform to pan slits.
In some areas the power (voltage) may be low.
Preheat the broil element for 10 minutes.
Oven temperature too hot
or too cold
Oven temperature needs adjustment. See the Special Features section.

24 49-80815-1
Problem Possible Cause What To Do
Oven does not work or
appears not to work
A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Oven controls improperly set. SeetheUsingtheOvensection.
Oven is in Sabbath Mode. Verify that the oven is not in Sabbath Mode. See the Special
Features section.
“Crackling” or “popping”
sound
This is the sound of the metal heating and
cooling during both the cooking and cleaning
functions.
This is normal.
Why is my range making
a "clicking" noise when
using my oven?
Your range cycles the heating elements by
turning relays on and off to maintain the oven
temperature.
This is normal.
Clock and timer do not
work
A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Plug on range is not completely inserted in the
electrical outlet.
Make sure electrical plug is plugged into a live, properly
grounded outlet.
Oven controls improperly set. SeetheUsingthekitchentimersection.
Clock display turned off CheckClockDisplaysettingsintheSpecialFeaturessection
Storage drawer won’t
close
Power cord may be obstructing drawer in the
lower back of the range.
Reposition the drawer and power cord. See the Storage
DrawerRemovalinstructionsintheCareandcleaningofthe
range section.
Drawerslideorrailimproperlyalignedwith
support
Repositionthedrawer.SeetheStorageDrawerRemoval
instructions in the Care and cleaning of the range section.
Oven door is crooked The door is out of position. Because the oven door is removable, it sometimes gets out
of position during installation. To straighten the door, re-install
thedoor.SeetheLift-OffOvenDoorinstructionsintheCare
and Cleaning section.
Oven light does not work Light bulb is loose or defective. Tighten or replace bulb.
Pad operating light is broken. Call for service.
Oven is in Sabbath mode Verify that the oven is not in Sabbath mode. See the Special
Features section.
Oven will not self-clean The temperature is too high to set a self-clean
operation.
Allow the oven to cool and reset the controls.
Oven controls improperly set. See the Cleaning the Oven section.
Doornotshut/closed Close the oven door completely.
Excessive smoking
during clean cycle
Excessive soil or grease. Press the Cancel/Off pad. Open the windows to rid the room
of smoke. Wait until the LOCKED light goes off. Wipe up the
excess soil and reset the clean cycle.
Excessive smoking
during broiling
Food too close to burner element. Lower the rack position of the food.
Oven door will not open
after a clean cycle
Oven too hot. Allow the oven to cool below locking temperature.
Oven not clean after a
clean cycle
Oven controls improperly set. See the Cleaning the Oven section.
Oven was heavily soiled. Clean up heavy spillovers before starting the clean cycle.
Heavily soiled ovens may need to self-clean again or for a
longer period of time.
"LOCK DOOR" flashes in
the display
The self-clean cycle has been selected but the
door is not closed.
Close the oven door. Latch the door for units that have a
manual latch.
DOOR LOCK light is on
when you want to cook
The oven door is locked because the
temperature inside the oven has not dropped
below the locking temperature.
Press the Cancel/Off pad. Allow the oven to cool.
“F— and a number
or letter” flash in the
display
You have a function error code. Press the Cancel/Off pad. Allow the oven to cool for one
hour. Put the oven back into operation.
If the function code repeats. Disconnectallpowertotheovenforatleast30secondsand
then reconnect power. If the function error code repeats, call
for service.
Troubleshooting Tips ... Before you call for service
TROUBLESHOOTING TIPS

49-80815-1 25
TROUBLESHOOTING TIPS
Problem Possible Cause What To Do
Display goes blank A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
The clock is turned off. See the Special features section.
Power outage, clock
flashes
Power outage or surge Reset the clock. If the oven was in use, you must reset it by
pressing the Cancel/Off pad, setting the clock and resetting any
cooking function.
“Burning” or “oily” odor
emitting from the vent
This is normal in a new oven and will
disappear in time.
To speed the process, set a self-clean cycle for a minimum of 3
hours. See the Cleaning the Oven section.
Strong odor An odor from the insulation around the
inside of the oven is normal for the first
few times the oven is used.
This is temporary and will go away after several uses or a self-
clean cycle.
Fan noise A convection fan may automatically turn
on and off.
This is normal on some models. The fan is designed to operate
intermittently to maximize cooking evenness. The convection fan
will operate during preheat of the bake cycle. The fan will turn off
after the oven is heated to the set temperature. This is normal.
A cooling fan may automatically turn on This is normal on some models. The cooling fan will turn off and
on to cool internal parts. It may run after the oven is turned off.
My oven door glass
appears to be "tinted" or
have a "rainbow" color. Is
this defective?
No. The inner oven glass is coated with
a heat barrier to reflect the heat back into
the oven to prevent heat loss and keep
the outer door cool while baking.
Thisisnormal.Undercertainlightorangles,youmayseethis
tint or rainbow color.
Sometimes the oven takes
longer to preheat to the
same temperature
Cookware or food in oven. The cookware or food in the oven will cause the oven to take
longer to preheat. Remove items to reduce preheat time.
Number of racks in oven. Adding more racks to the oven will cause the oven to take
longer to preheat. Remove some racks.
Differentcookingmodes. The different cooking modes use different preheat methods to
heat the oven for the specific cooking mode. Some modes will
take longer than others (i.e. convection bake).
Display flashes Power failure. Reset the clock.
Unable to get the display
to show “oFFSEt”
Oven control pads were not touched
properly.
The Broil Hi/Lo and Bake pads must be touched at the same
time and held for 3 seconds.
Control signals after
entering cooking time or
start time
You forgot to enter a bake temperature or
cleaning time.
Touch the Bake pad and desired temperature or the Self Clean
pad and desired clean time.
Oven racks are difficult to
slide
The shiny, silver-colored racks were
cleaned in a self-clean cycle.
Apply a small amount of vegetable oil to a paper towel and wipe
theedgesoftheovenrackswiththepapertowel.Donotspray
with Pam
®
or other lubricant sprays.
Drawer does not slide
smoothly or drags
The drawer is out of alignment. Fully extend the drawer and push it all the way in See the Care
and cleaning of the range section.
Drawerisover-loadedorloadis
unbalanced.
Reduce weight. Redistribute drawer contents.
Steam from the vent When using the ovens, it is normal to see
steam coming out of the oven vents. As
the number of racks or amount of food
being cooked increases, the amount of
visible steam will increase.
This is normal.
Water remaining on oven
floor after Steam Clean
cycle
This is normal. Remove any remaining water with a dry cloth or sponge.
Oven will not steam clean DisplayflashesHOT. Allow the oven to cool to room temperature and reset the
controls.
Oven controls improperly set. SeetheUsingSteamCleansection.
Oven door is not closed. Make sure you close the door to start steam clean cycle.
Troubleshooting Tips ... Before you call for service

26 49-80815-1
GEAppliances.com
All warranty service is provided by our Factory Service Centers, or an authorized Customer Care
®
technician. To schedule
service online, visit us at GEAppliances.com/service, or call GE Appliances at 800.GE.CARES (800.432.2737). Please
have your serial number and your model number available when calling for service.
Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE Appliances factory
service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its
products by providing GE Appliances with information on your appliance. If you do not want your appliance data to be
sent to GE Appliances, please advise your technician not to submit the data to GE Appliances at the time of service.
What GE Appliances will not cover:
■ Service trips to your home to teach you how to use
the product.
■ Improperinstallation,deliveryormaintenance.
■ Failureoftheproductifitisabused,misused,
modified or used for other than the intended purpose
or used commercially.
■ Damagetotheglasscooktopcausedbyuseof
cleaners other than the recommended cleaning
creams and pads.
■ Damagetotheglasscooktopcausedbyhardened
spills of sugary materials or melted plastic that
are not cleaned according to the directions in the
Owner's Manual.
■ Replacementofhousefusesorresettingofcircuit
breakers.
■ Damagetotheproductcausedbyaccident,fire,
floods or acts of God.
■ Damagetofinish,suchassurfacerust,tarnish,orsmall
blemishes not reported within 48 hours of delivery.
■ Incidentalorconsequentialdamagecausedby
possible defects with this appliance.
■ Damagecausedafterdelivery.
■ Productnotaccessibletoproviderequiredservice.
■ Servicetorepairorreplacelightbulbs,exceptfor
LEDlamps.
EXCLUSION OF IMPLIED WARRANTIES
Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties,
including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or
the shortest period allowed by law.
This limited warranty is extended to the original purchaser and any succeeding owner for products purchased for
homeusewithintheUSA.IftheproductislocatedinanareawhereservicebyaGEAppliancesAuthorizedServicer
is not available, you may be responsible for a trip charge or you may be required to bring the product to an Authorized
GE Appliances Service location for service. In Alaska, the limited warranty excludes the cost of shipping or service
calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This limited warranty
gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your
legal rights are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: GE Appliances, a Haier company
Louisville,KY40225
Extended Warranties: Purchase a GE Appliances extended warranty and learn about special discounts that are
available while your warranty is still in effect. You can purchase it online anytime at
GEAppliances.com/extended-warranty
or call 800.626.2224 during normal business hours. GE Appliances Service will still be there after your warranty expires.
For the period of GE Appliances will replace
One year
From the date
of the original
purchase
Any partoftherangewhichfailsduetoadefectinmaterialsorworkmanship.Duringthis
limited one-year warranty, GE Appliances will provide, free of charge, all labor and in-home
service to replace the defective part.
Staple your receipt here. Proof of the original purchase
date is needed to obtain service under the warranty.
LIMITED WARRANTY
GE Appliances Electric Range Limited Warranty

49-80815-1 27
ACCESSORIES
Looking For Something More?
GE Appliances offers a variety of accessories to
improve your cooking and maintenance experiences!
Refer to the Consumer Support page for phone numbers
and website information.
The following products and more are available:
Accessories
Accessories
Small Broiler Pan (8 ¾ ” x 1 ¼” x 13 ½ “)
Large Broiler Pan (12 ¾ ” x 1 ¼” x 16 ½ “)
XLBroilerPan(17”x1¼”x191/4“)
Parts
Oven racks
Oven elements
Light bulbs
Cleaning Supplies
CitruShine™ Stainless Steel Wipes
CERAMA BRYTE
®
Stainless Steel Appliance Cleaner
CERAMA BRYTE
®
Cleaning Pads for Ceramic Cooktops
CERAMA BRYTE
®
Ceramic Cooktop Cleaner
CERAMA BRYTE
®
Ceramic Cooktop Scraper
Kit(Kitincludescreamandcooktopscraper)
*Thelargebroilerpandoesnotfitin20”/24”ranges.
**TheXLbroilerpandoesnotfitin24”wallovens,27”drop-insor20”/24”range.

28 49-80815-1
PrintedintheUnitedStates
Consumer Support
CONSUMER SUPPORT
GE Appliances Website
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day
of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support
servicesdesignedforyourconvenience.IntheUS:GEAppliances.com
Register Your Appliance
Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also mail in
thepre-printedregistrationcardincludedinthepackingmaterial.IntheUS:GEAppliances.com/register
Schedule Service
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
yourconvenienceanydayoftheyear.IntheUS:GEAppliances.com/service
or call 800.432.2737 during normal business hours.
Extended Warranties
Purchase a GE Appliances extended warranty and learn about special discounts that are available while your
warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your
warrantyexpires.IntheUS:GEAppliances.com/extended-warranty
or call 800.626.2224 during normal business hours.
Remote Connectivity
For assistance with wireless network connectivity (for models with remote enable),
visit our website at GEAppliances.com/connected-home-smart-appliances/orcall800.220.6899intheUS.
Parts and Accessories
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes
(VISA,MasterCardandDiscovercardsareaccepted).Orderon-linetoday24hourseveryday.
IntheUS:GEApplianceparts.com or by phone at 877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing
generally should be referred to qualified service personnel. Caution must be exercised, since improper
servicing may cause unsafe operation.
Contact Us
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the
details including your phone number, or write to:
IntheUS:GeneralManager,CustomerRelations|GEAppliances,AppliancePark|Louisville,KY40225
GEAppliances.com/contact
