
Owner’s
Manual
Side-by-Side
36”, 42”, 48”
Built-In Refrigerators
monogram.com

Consumer Information
Built-In Refrigerators
2
Contents
Consumer Services
Important Phone Numbers .................27
Model and Serial Numbers ....................3
Problem Solver ..........................22–25
Product Registration .........................3
Safety Instructions ........................ 4–7
Smartwater Filter Performance
Data Sheet .................................26
Warranty ......................... Back Cover
Care and Cleaning
&OHDQLQJ³2XWVLGHDQG,QVLGH ...............19
Moving and Vacation .......................21
Master Light Switch ........................20
Operating Instructions
Automatic Icemaker ........................12
Climate Control Drawer. . . . . . . . . . . . . . 13, 14, 16
Control Lock ...............................14
Ice and Water Dispenser ................10, 11
Shelves and Bins ........................17, 18
Storage Pans ...........................15, 16
Temperature Controls ........................8
Water Filter Cartridge ........................9
Sabbath Mode Product Kit, ZSAB1. . . . . . . . . . . 18

3
If you
received a
damaged
refrigerator
Immediately contact the dealer (or builder) that
sold you the refrigerator.
Save time
& money
Before you request service, check the
Problem Solver in the back of this manual.
It lists causes of minor operating problems that
you can correct yourself.
If you
need
service
To obtain service, see the Consumer Services
page in the back of this manual.
We’re proud of our service and want you to be
pleased. If for some reason you are not happy
with the service you receive, here are steps to
follow for further help.
For customers in the USA:
FIRST, contact the people who serviced your
appliance. Explain why you are not pleased.
In most cases, this will solve the problem.
NEXT, if you are still not pleased, write all the
GHWDLOV³LQFOXGLQJ\RXUSKRQHQXPEHU³WR
Manager, Customer Relations
GE Appliances
Appliance Park
Louisville, KY 40225
For customers in Canada:
FIRST, contact the people who serviced your
appliance. Explain why you are not pleased.
In most cases, this will solve the problem.
NEXT, if you are still not pleased, write all
WKHGHWDLOV²LQFOXGLQJ\RXUSKRQHQXPEHUWR
Manager, Consumer Relations
Mabe Canada Inc.
1 Factory Lane, Suite 310
Moncton, N.B. E1C 9M3
Consumer Information
Built-In Refrigerators
Before
using your
refrigerator
Read this manual carefully. It is intended
to help you operate and maintain your new
refrigerator properly.
Keep it handy for answers to your questions.
If you don’t understand something or need more
help, there is a list of toll-free consumer service
numbers included in the back section of this
manual.
OR
9LVLWRXUZHEVLWHDWmonogram.com
Write
down the
model
& serial
numbers
You’ll see them on a label in the lower right hand
side of the fresh food compartment beneath
the climate control drawer.
Before sending in the Product Registration
card, please write these numbers here:
Model Number
Serial Number
Use these numbers in any correspondence or
service calls concerning your refrigerator.

4
,03257$176$)(7<,16758&7,216
GE Appliances Website
For more information on your refrigerator’s operation, visit www.GEAppliances.com or
call 800.GECARES (800.432.2737). In Canada visit GEAppliances.ca or call 800.561.3344.
This is the safety alert symbol. This symbol alerts you to potential hazards that can kill or hurt you and others. All safety
PHVVDJHVZLOOIROORZWKHVDIHW\DOHUWV\PERODQGWKHZRUG´'$1*(5µ´:$51,1*µRU´&$87,21µ7KHVHZRUGVDUHGHILQHGDV
Indicates a hazardous situation which, if not avoided, will result in death or serious injury.
Indicates a hazardous situation which, if not avoided, could result in death or serious injury.
Indicates a hazardous situation which, if not avoided, could result in minor or moderate injury.
IMPORTANT SAFETY INSTRUCTIONS
To reduce the risk of fire, explosion, electric shock, or injury when using your
UHIULJHUDWRUIROORZWKHVHEDVLFVDIHW\SUHFDXWLRQV
REFRIGERATOR SAFETY INFORMATION
WARNING
WARNING
DANGER
CAUTION
In refrigerators with automatic icemakers, avoid contact with
the moving parts of the ejector mechanism, or with the heating
element that releases the cubes. Do not place fingers or hands
on the automatic ice making mechanism while the refrigerator is
plugged in.
Do not clean glass shelves or covers with warm water when they
are cold. Glass shelves and covers may break if exposed to sudden
temperature changes or impact, such as bumping or dropping.
Tempered glass is designed to shatter into many small pieces if it
breaks.
Keep fingers out of the “pinch point” areas; clearances between the
doors and between the doors and cabinet are necessarily small. Be
careful closing doors when children are in the area.
Do not touch the cold surfaces in the freezer compartment when
hands are damp or wet, skin may stick to these extremely cold
surfaces.
Do not refreeze frozen foods which have thawed completely.
To reduce the risk of injury when using your refrigerator, follow these basic
precautions.
This refrigerator must be properly installed and located in
accordance with the Installation Instructions before it is used.
Replace all parts and panels before operating.
Do not store or use gasoline or other flammable vapors and liquids
in the vicinity of this or any other appliance.
Because of potential safety hazards under certain conditions,
we strongly recommend against the use of an extension cord.
However, if you must use an extension cord, it is absolutely
necessary that it be a UL-listed (in the United States) or a CSA
certified (in Canada), 3-wire grounding type appliance extension
cord having a grounding type plug and outlet and that the
electrical rating of the cord be 15 amperes (minimum) and 120
volts.
To prevent suffocation and entrapment hazards to children,
remove the fresh food and freezer doors from any refrigerator
before disposing of it or discontinuing its use.
Do not allow children to climb, stand or hang on the door handles
or the shelves in the refrigerator. They could seriously injure
themselves.
8QSOXJWKHUHIULJHUDWRU
• To disconnect power to the refrigerator. It cannot be turned off
by any setting on the control panel.
• To clean, replace a burned out light bulb, or make repairs.
Note: Repairs must be performed by a qualified Service
Professional.
CAUTION
State of California Proposition 65 Warnings:
WARNING
This product contains one or more chemicals known to the State of California to cause cancer
and birth defects or other reproductive harm.

5
,03257$17(6,16758&7,216'(6e&85,7e
Dans les réfrigérateurs qui ont des machines à glaçons, évitez tout
contact avec les éléments mobiles du mécanisme d’éjection ou avec
l’élément chauffant situé à la partie inférieure de la machine à glaçons. Ne
mettez jamais vos doigts ou vos mains sur le mécanisme de fabrication
automatique de glaçons quand le réfrigérateur est branché.
Ne nettoyez pas les clayettes ou les couvercles en verre avec de l’eau
tiède quand ceux-ci sont froids. Les clayettes et couvercles en verre
peuvent se casser s’ils sont exposés à des changements soudains de
température ou si vous les cognez ou les faites tomber. Le verre trempé
est conçu pour se briser en petits morceaux en cas de casse.
Ne laissez jamais vos doigts dans des endroits où ils risquent d’être pincés.
L’écartement entre les portes et l’armoire est nécessairement petit. Faites
attention de fermer les portes quand des enfants se trouvent à proximité.
Ne touchez jamais les surfaces froides dans le compartiment congélation
quand vos mains sont humides ou mouillées. Votre peau peut coller à ces
surfaces extrêmement froides.
Ne recongelez pas les aliments surgelés qui ont complètement dégelé.
Pour réduire le risque de blessures lorsque vous utilisez votre réfrigérateur,
YHXLOOH]VXLYUHFHVFRQVLJQHVGHVpFXULWp
Vous devez bien installer et placer votre réfrigérateur,
conformément aux Instructions d’installation avant de l’utiliser.
Remettez toutes les pièces et panneaux en place avant d’utiliser
l’appareil.
Ne conservez jamais ou n’utilisez jamais d’essence ou d’autres
liquides ou gaz inflammables à proximité de votre réfrigérateur ou
de tout autre appareil électroménager.
Nous déconseillons fortement l’utilisation d’une rallonge à cause
des risques potentiels dans certaines conditions. Cependant, si
l’utilisation d’un cordon prolongateur est nécessaire, ce dernier doit
obligatoirement être homologué UL (aux USA) ou CSA (au Canada),
à trois brins avec mise à la terre pour appareil électroménager et
doit être équipé d’une fiche et d’une prise femelle avec terre. Les
caractéristiques électriques du cordon prolongateur doivent être de
15 ampères (minimum) et de 120 volts.
Pour éviter les risques d’asphyxie et d’enfermement pour les
enfants. Démontez les portes du congélateur et du compartiment
de réfrigération avant de le mettre au rebut ou d’interrompre son
utilisation.
Ne permettez jamais aux enfants de grimper, de monter, de se
tenir ou de se pendre aux étagères de votre réfrigérateur. Ils
peuvent endommager le réfrigérateur et se blesser sérieusement.
'pEUDQFKH]YRWUHUpIULJpUDWHXU
• Pour débrancher le réfrigérateur. L’alimentation électrique du
réfrigérateur ne peut pas être coupée par l’intermédiaire du
panneau de commande.
• Débranchez votre réfrigérateur avant de le nettoyer, Avant de
remplacer une ampoule grillée, et de le réparer.
NOTE : Nous vous recommandons fortement de faire accomplir
tout service par un technicien qualifié.
Site Internet d’Électroménagers GE
Pour de plus amples informations sur le fonctionnement de votre réfrigérateur, consultez le
site www.electromenagersge.ca ou composez le 800.561.3344.
CONSIGNES DE SÉCURITÉ POUR LE RÉFRIGÉRATEUR
IMPORTANTES CONSIGNES DE SÉCURITÉ
Pour réduire le risque d’incendie, d’explosion, de choc électrique ou de blessures
ORUVTXHYRXVXWLOLVH]YRWUHUpIULJpUDWHXUYHXLOOH]VXLYUHFHVFRQVLJQHVGHVpFXULWp
AVERTISSEMENT
Ce symbole représente une alerte de sécurité. Ce symbole vous avise de dangers possibles pouvant causer
la mort, des blessures ou autres. Tous les messages de sécurité seront précédés du symbole d’alerte de sécurité
DLQVLTXHGHVPRWV©'$1*(5ª©$9(57,66(0(17ªRX©0,6((1*$5'(ª&HVPHVVDJHVVRQWOHVVXLYDQWV
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, entraînera des blessures
graves, voire la mort.
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures graves, voire la mort.
.
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures mineures ou graves.
AVERTISSEMENT
DANGER
ATTENTION
ATTENTION
Avertissements de la Proposition 65 de l’État de la Californie :
AVERTISSEMENT
&HSURGXLWFRQWLHQWXQHRXSOXVLHXUVVXEVWDQFHVFKLPLTXHVUHFRQQXHVSDUO·eWDWGH&DOLIRUQLH
pour causer le cancer et des anomalies congénitales ou d’autres problèmes liés à la reproduction.

6
,03257$176$)(7<,16758&7,216
USE OF EXTENSION CORDS
Because of potential safety hazards under certain conditions, we strongly recommend against the use of an extension cord.
However, if you must use an extension cord, it is absolutely necessary that it be a UL-listed (in the United States) or a CSA-
listed (in Canada), 3-wire grounding type appliance extension cord having a grounding type plug and outlet and that the
electrical rating of the cord be 15 amperes (minimum) and 120 volts.
READ AND FOLLOW THIS SAFETY INFORMATION CAREFULLY.
SAVE THESE INSTRUCTIONS
Do not, under any circumstances, cut or remove the third (ground) prong from the power cord.
For personal safety, this appliance must be properly grounded.
The power cord of this appliance is equipped with a 3-prong
(grounding) plug which mates with a standard 3-prong
(grounding) wall outlet to minimize the possibility of electric shock
hazard from this appliance.
Have the wall outlet and circuit checked by a qualified electrician
to make sure the outlet is properly grounded.
Where a standard 2-prong wall outlet is encountered, it is your
personal responsibility and obligation to have it replaced with a
properly grounded 3-prong wall outlet. Do not use an adapter.
The refrigerator should always be plugged into its own individual
electrical outlet which has a voltage rating that matches the
rating plate. This provides the best performance and also
prevents overloading house wiring circuits which could cause a
fire hazard from overheated wires.
Never unplug your refrigerator by pulling on the power cord.
Always grip plug firmly and pull straight out from the outlet.
Repair or replace immediately all power cords that have become
frayed or otherwise damaged. Do not use a cord that shows
cracks or abrasion damage along its length or at either end.
When moving the refrigerator away from the wall, be careful not
to roll over or damage the power cord.
CONNECTING ELECTRICITY
WARNING
Electrical Shock Hazard.
Plug into a grounded 3-prong outlet
Do not remove the ground prong
Do not use an adapter
Failure to follow these instructions can result in
death, fire, or electrical shock.
WARNING
Suffocation and child entrapment hazard.
Remove fresh-food and freezer doors from the refrigerator, prior to disposal. Failure to do so can result
in child entrapment which can lead to death or brain damage.
Child entrapment and suffocation are not problems of the past.
Junked or abandoned refrigerators are still dangerous even if
they will sit for “just a few days.” If you are getting rid of your old
refrigerator, please follow the instructions below to help prevent
accidents.
Before You Throw Away Your Old Refrigerator or Freezer:
Take off the fresh food and freezer doors.
Leave the shelves in place so that children may not easily
climb inside.
Refrigerants
All refrigeration products contain refrigerants, which under
federal law must be removed prior to product disposal. If you
are getting rid of an old refrigeration product, check with the
company handling the disposal about what to do.
PROPER DISPOSAL OF YOUR OLD REFRIGERATOR
IMPORTANT:
WARNING
Explosion Hazard.
Keep flammable materials and vapors, such as gasoline, away from freezer. Failure to do so can result
in fire, explosion, or death.
INSTALLATION

7
,03257$17(6,16758&7,216'(6e&85,7e
/,6(=(768,9(=62,*1(86(0(17&(60(685(6'(6e&85,7e
CONSERVEZ CES INSTRUCTIONS
UTILISATION DE RALLONGES ÉLECTRIQUES
Nous vous recommandons fortement de ne pas utiliser de rallonge électrique, à cause d’un danger de risques possibles de
sécurité dans certaines conditions.
Cependant, si vous devez absolument utiliser un cordon rallonge électrique, il est absolument requis que vous utilisiez un
FRUGRQUDOORQJHWULILODLUHDYHFPLVHjODWHUUHFHUWLILp8/DX[eWDWV8QLVRX$&125DX&DQDGDDYHFSULVHHWILFKHjWURLV
conducteurs, et à notation électrique de 15 ampères (minimum) et 120 volts.
BRANCHEMENTS ÉLECTRIQUES
AVERTISSEMENT
Risque de choc électrique.
Branchez l’appareil dans une prise triple avec terre.
Ne retirez pas la broche de terre.
N’utilisez pas d’adaptateur.
Le non-respect de ces instructions peut entraîner des
risques d’incendies, des chocs électriques ou la mort.
Ne coupez pas ou n’enlevez pas, sous aucun prétexte, la troisième broche de mise à la terre du cordon
d’alimentation. Pour des raisons de sécurité, cet appareil doit être correctement mis à la terre.
Le cordon d’alimentation de cet appareil est équipé d’une fiche
à trois broches (pour une mise à la terre) qui s’adapte à la prise
de courant standard à 3 broches (pour une mise à la terre) pour
minimiser les risques de chocs électriques par cet appareil.
Faites vérifier la prise murale et le circuit électrique par
un électricien qualifié pour s’assurer que le système est
correctement mis à la terre.
Dans le cas d’une prise biphasée, l’installateur a la responsabilité
et l’obligation de la remplacer par une prise triphasée
correctement mise à la terre. N’utilisez pas d’adaptateur.
Le réfrigérateur doit toujours être branché à sa propre prise
électrique d’une tension nominale correspondant à celle
indiquée sur sa plaque signalétique.
Une alimentation électrique à 115 volts CA, 60 Hz, avec
un fusible de 15 ou 20 ampères et une mise à la terre est
nécessaire. Ceci permet d’obtenir un meilleur rendement et évite
de surcharger les circuits électriques du domicile qui risque
d’occasionner un incendie en surchauffant.
Ne débranchez jamais le réfrigérateur en tirant sur le cordon
d’alimentation. Prenez toujours fermement la fiche en main et
tirez pour la sortir de la prise.
Réparez ou remplacez immédiatement tout cordon électrique
usé ou endommagé. N’utilisez pas un cordon fissuré ou
présentant des dommages dus aux frottements soit sur sa
longueur ou aux extrémités.
Lorsque vous éloignez votre réfrigérateur du mur, faites
attention à ne pas le faire rouler sur le cordon d’alimentation
afin de ne pas l’endommager.
MISE AU REBUT APPROPRIÉE DE VOTRE ANCIEN RÉFRIGÉRATEUR
AVERTISSEMENT
Un enfant risque de suffoquer ou d’y être emprisonné.
Démontez les portes du compartiment de réfrigération et du compartiment de congélation du réfrigérateur,
avant mettre celui-ci au rebut. Le non-respect de cette recommandation peut entraîner l’enfermement d’un
enfant qui peut entraîner la mort ou des lésions cérébrales.
Les enfants pris au piège ou morts d’asphyxie sont toujours
d’actualité. Les réfrigérateurs jetés ou abandonnés restent
dangereux même si vous ne les laissez au rebut que pour «
quelques jours ». Si vous voulez jeter votre ancien réfrigérateur,
suivez les instructions suivantes pour empêcher les accidents.
Avant de jeter votre ancien réfrigérateur ou congélateur:
Démontez les portes du compartiment de réfrigération et du
compartiment de congélation.
Laissez les clayettes en place, pour éviter que des enfants
puissent facilement grimper dans votre réfrigérateur.
Fluides frigorigènes
Les appareils réfrigérants contiennent des fluides
frigorigènes qui conformément à la législation fédérale
doivent être retirés avant la mise au rebut de l’appareil. Si
vous mettez au rebut un ancien réfrigérateur contenant des
fluides frigorigènes, vérifiez la procédure à suivre auprès de
la compagnie responsable de l’élimination.
IMPORTANT:
INSTALLATION
AVERTISSEMENT
Risque d’explosion.
Conservez les matériaux et vapeurs inflammables tels que l’essence à l’écart de votre congélateur. Une
explosion, un incendie voire la mort pourrait en résulter.

8
Temperature Controls
Built-In Refrigerators
Temperature
controls
Changing
display
temperatures
from °F to °C
To change the temperature display between
Fahrenheit and Celsius, press Display Mode °C/°F.
The temperature display shows the actual
temperature of the freezer and fresh food
compartments. The actual temperature will vary
from the set temperature based on factors such
as door opening, amount of food, defrost cycling
and room temperature.
NOTE: Frequent door openings or door left open
for periods of time may increase the internal
temperature of the freezer and fresh food
compartments temporarily.
To turn off the cooling system in both the
freezer and fresh food compartments, press
either (+) pad until both displays show OFF.
To turn the cooling system on, press either (-)
pad. The preset temperatures of 0°F and 37°F
will appear in the display.
To check the current temperature setting
for the fresh food or freezer compartment,
press the (+) or (-) pad once. After 5 seconds, the
display will return to the actual temperature.
To change the temperature settings, press the
(+) or (-) pads to desired temperature set point for
fresh food and freezer separately. Allow 24 hours
for the refrigerator to reach the temperature you
have set.
Temperature Ranges
Low High
Fresh Food
Freezer
NOTE: Setting the controls to OFF stops cooling,
but does not shut off electrical power to the
refrigerator.
34°F
1°C
–6°F
–21°C
42°F
5°C
+4°F
–15°C
Door
alarm
To turn the Door Alarm feature on, press
DOOR ALARM once. The ACTIVE light will come
on. To turn it off, press it again.
2QPRGHOVZLWKDGLVSHQVHUWKH'RRU$ODUP
feature is located on the dispenser panel on the
front of the freezer door.
When the DOOR ALARM is active, the alarm will
flash and beep if you keep the door open for
more than 2 minutes.
3UHVHW6HWWLQJV
Allow 24 hours to reach these preset temperatures.
Dispenser Models
Non-Dispenser Models

9
Water filter
cartridge
Water Filter Cartridge
Built-In Refrigerators
Water filter cartridge
The water filter cartridge is located behind the top
access panel.
When to replace the filter
2QGLVSHQVHUPRGHOVWKHUHLVDUHSODFHPHQW
indicator light for the water filter cartridge
RQWKHGLVSHQVHU2QQRQGLVSHQVHUPRGHOV
the replacement indicator is located on the
temperature control panel. This light will turn
orange to tell you that you need to replace the filter
soon.
The filter cartridge should be replaced when the
replacement indicator light turns red or if the flow
of water to the dispenser or icemaker decreases.
Removing the filter cartridge
If you are replacing the cartridge, first remove the old
one by slowly turning it to the left. Do not pull down on
the cartridge. A small amount of water may drip down.
NOTE: To reduce the risk associated with property
damage due to water leakage, read and follow
instructions before installation and use of this
system. Installation and use MUST comply with all
state and local plumbing codes.
Installing the filter cartridge
1
Fill the replacement cartridge with water from the
tap to allow for better flow from the dispenser
immediately after installation.
2
Line up the arrow on
the cartridge and the
cartridge holder. Place
the top of the new
cartridge up inside the
holder. Do not push it up
into the holder.
3
Slowly turn it to the right until the filter cartridge
stops. DO NOT OVERTIGHTEN. As you turn the
cartridge, it will automatically raise itself into
position. The cartridge will move about 1/2 turn.
4
2QGLVSHQVHUPRGHOVUXQZDWHUIURPWKH
dispenser for 1-1/2 gallons (about 3 minutes) to
clear the system and prevent sputtering.
5
Press and hold the RESET WATER FILTER pad,
located on the dispenser or temperature control
panel depending on the model, for three seconds
to clear the red or amber light.
NOTE$QHZO\LQVWDOOHGZDWHUILOWHUFDUWULGJHPD\
cause water to spurt into the icemaker.
Filter bypass plug
You must use the filter bypass plug when a
replacement filter cartridge is not available. The
icemaker will not operate without the filter or filter
bypass plug.
)RUWKHPD[LPXPEHQH¿WRI\RXU¿OWUDWLRQV\VWHP*($SSOLDQFHVUHFRPPHQGVWKHXVHRI*($SSOLDQF-
HVEUDQGHG¿OWHUVRQO\8VLQJ*($SSOLDQFHVEUDQGHG¿OWHUVLQ*($SSOLDQFHV+RWSRLQWDQG0RQRJUDP
UHIULJHUDWRUVSURYLGHVRSWLPDOSHUIRUPDQFHDQGUHOLDELOLW\*($SSOLDQFHV¿OWHUVPHHWULJRURXVLQGXVWU\16)
VWDQGDUGVIRUVDIHW\DQGTXDOLW\WKDWDUHLPSRUWDQWIRUSURGXFWVWKDWDUH¿OWHULQJ\RXUZDWHU*($SSOLDQFHV
KDVQRWTXDOL¿HGQRQ*($SSOLDQFHVEUDQGHG¿OWHUVIRUXVHLQ*($SSOLDQFHVDQG+RWSRLQWUHIULJHUDWRUVDQG
WKHUHLVQRDVVXUDQFHWKDWQRQ*($SSOLDQFHVEUDQGHG¿OWHUVPHHW*($SSOLDQFHVVWDQGDUGVIRUTXDOLW\
performance and reliability.
,I\RXKDYHTXHVWLRQVRUWRRUGHUDGGLWLRQDO¿OWHUFDUWULGJHVYLVLWRXUZHEVLWHDWZZZJHZDWHU¿OWHUV
com or call GE Appliances Parts and Accessories, 877.959.8688.
Customers in Canada should consult the yellow pages for the nearest Camco Service Center.
Cartridge
Holder
Filter Bypass
Plug
SmartWater

10
Dispenser
with
glass-touch
controls
How it Works
The electronic controls on the dispenser are truly
interactive. The control panel is equipped with a
proximity sensor that causes the panel to light
up as you approach the dispenser (approx. 2
inches). To make a selection, simply touch the
graphic for the feature you want, and the halo
for that feature will light up. When you walk
away from the refrigerator, the lighted graphics
switch off automatically.
Spill Shelf
Ice & Water Dispenser (on some models)
Built-In Refrigerators
How to Use
7RGLVSHQVHZDWHURULFHVHOHFWWATER , CUBED
ICE or CRUSHED ICE . Then press the glass
gently against the top of the dispenser cradle.
The spill shelf is not self-draining. To reduce
water spotting, the shelf and its grille should be
cleaned regularly.
If no water is dispensed when the refrigerator is
first installed, there may be air in the water line
system. Press the dispenser cradle for at least
two minutes to remove trapped air from the
water line and to fill the water system. To flush
out impurities in the water line, throw away the
first gallon of water.
CAUTION
Never put fingers or any
other objects into the ice crusher discharge
opening.
ATTENTION
Ne mettez jamais les
doigts ou d’autres objets dans l’ouverture du
distributeur.
Locking the Dispenser:
Touch CONTROL LOCK for
3 seconds to lock the dispenser
and control pad. To unlock, touch
it again for 3 seconds.
Dispenser Light:
This feature turns the light on and
off. The light also comes
on when the dispenser cradle is
pressed. If this light burns out,
contact factory service.
Door Alarm:
To turn the Door Alarm feature on,
touch DOOR ALARM once. To turn
it off, press it again.
When the DOOR ALARM is active,
the alarm will flash and beep if you
keep the door open for more than
2 minutes.

11
Ice storage
bin
To remove:
Lift up the access door to reach the icemaker.
Set the icemaker power switch to the OFF
position. With the access door closed, support
the storage bin at the bottom while slightly
lifting. Pull bin straight out.
To replace:
Slide the bin back until the tab on the bin locks
into the slot on the shelf. If the bin does not go
all the way back, remove it and rotate the drive
mechanism 1/4 turn. Then push the bin back
again.
Important
facts about
your ice
& water
dispenser
• Do not add ice from trays or bags to the
storage bin. It may not crush or dispense well.
• Avoid overfilling glass with ice and use of
narrow or extra-tall glasses. Backed-up ice
can jam the chute or cause the door in the
chute to freeze shut. If ice is blocking the
chute, push it through with a wooden spoon.
• Beverages and foods should not be quick-
chilled in the ice storage bin. Cans, bottles or
food packages in the storage bin may cause
the icemaker or auger to jam.
• To keep dispensed ice from missing the glass,
put the glass close to, but not touching, the
dispenser opening.
• Some crushed ice may be dispensed even
though you selected CUBES. This happens
occasionally when a few cubes accidentally
get directed to the crusher.
• After crushed ice is dispensed, some water
may drip from the chute as small particles of
ice melt.
• Sometimes a mound of ice chips will form
on the door in the ice chute. This condition
is normal and usually occurs when you have
dispensed crushed ice repeatedly. The ice
chips will eventually evaporate.
• Dispensed water is not ice cold. For colder
water, simply add crushed ice or cubes before
dispensing water.
• The first glass of water dispensed may be
warmer than the following ones. This is
normal.
• To eliminate drips on the spill shelf, tilt the
glass in slightly when dispensing water.
Rotate
Drive
Mechanism
Ice Storage Bin
Access Door
Ice & Water Dispenser (on some models)
Built-In Refrigerators

12
Automatic
icemaker
CAUTION
Avoid contact with the moving
parts of the ejector mechanism, or with the heating
element (located on the bottom of the icemaker)
that releases the cubes. Do not place fingers or
hands on the automatic ice making mechanism
while the refrigerator is plugged in.
ATTENTION
eYLWH]WRXWFRQWDFWDYHFOHV
pièces mobiles du mécanisme d’éjection ou
l’élément chauffant (situé dans le bas de la
machine à glaçons) qui libère les cubes. Ne placez
pas les doigts ou les mains sur le mécanisme de
production de glace automatique lorsque le
réfrigérateur est branché dans la prise électrique.
A newly-installed refrigerator may take 12–24
hours to begin making ice.
The icemaker will produce seven cubes per
F\FOH³DSSUR[LPDWHO\F\FOHVLQDKRXU
period, depending on freezer compartment
temperature, room temperature, number of door
openings and other use conditions.
If the refrigerator is operated before the water
connection is made to the icemaker, set the
power switch to OFF.
When the refrigerator has been connected to the
water supply, set the power switch to
ON
.
Throw away the first full bucket of ice.
Be sure nothing interferes with the sweep of the
feeler arm.
When the bin fills to the level of the feeler arm,
the icemaker will stop producing ice.
It is normal for several cubes to be joined
together.
If ice is not used frequently, old ice cubes will
become cloudy, taste stale and shrink.
NOTE: Icemaker works best between 40 and 120
PSI home water pressure.
Automatic Icemaker
Built-In Refrigerators
Feeler Arm
Icemaker
Power
Switch

13
Climate
Control
drawer
How it Works
The Climate Control feature is a system of
dampers, a fan, a temperature thermistor, and a
heater. The Climate Control drawer can be used to
chill items quickly, thaw foods quickly or store items
at their optimum temperatures.
The drawer is tightly sealed to prevent the drawer’s
temperature from causing temperature fluctuations
in the rest of the refrigerator.
6(/(&77(03³Use this feature to store items
at their optimum temperatures. The CITRUS
setting will maintain a drawer temperature of
39–47°F by cycling a small heater off and on as
needed. The PRODUCE setting will maintain the
drawer temperature at 31–38°F by drawing in
additional cold air as needed. The MEAT setting
will maintain the drawer temperature at 27–37°F
by drawing in additional cold air as needed.
(;35(66&+,//³This feature can be used
to cool items in minutes, rather than hours.
Extra cool air is circulated throughout the
GUDZHU2QFHWKHF\FOHLVFRPSOHWHWKHGUDZHU
will revert to the pre-set fresh food temperature.
(;35(667+$:³This feature thaws items
in hours rather than days. Food is gently
thawed in a cool environment by circulating
air throughout the drawer. Temperature is
maintained in the drawer by cycling a small
KHDWHURIIDQGRQDVQHHGHG2QFHWKHWKDZ
cycle is complete, the pan will automatically
adjust to a temperature of 27–37°F to store
the food at its optimum temperature.
NOTE: By turning the controls on the Climate
Control drawer off, the drawer can be used as
a standard sealed produce pan.
How to Use
1 Empty the drawer. Place the items in
the drawer.
2 Select the Express Thaw,™ Express Chill™
or Select Temp™ pad. The display will come
on. Press the pad until the light appears next
to the desired setting. Use the chart on
the next page to determine the best setting.
• To stop a feature before it is finished,
press that feature’s pad until no options
are selected and the display is off.
• During Express Thaw™ and Express Chill,™
the display on the controls will count down
the time remaining in the cycle.
• After the Express Thaw™ cycle is complete,
the drawer will reset to the MEAT setting
(27–37°F) to help preserve thawed items
until they are used.
• The displayed actual temperature of
the Climate Control drawer may vary slightly
from the SET temperature based on usage
and operation environment.
NOTE: For food safety reasons, it is
recommended that foods be wrapped in
plastic wrap when using Express Thaw.™
This will help contain meat juices and
improve thawing performance.
Express Thaw™
Express Chill™
Climate Control Drawer
Built-In Refrigerators

14
Climate
Control
chart
NOTE: Results may vary depending on packaging, starting temperature and other food traits.
Climate Control Drawer
Built-In Refrigerators
Citrus Setting (39–47°F)
• 2UDQJHV/HPRQV/LPHV
Pineapple, Cantaloupe
• Beans, Cucumbers, Tomatoes,
Peppers, Eggplant, Squash
Produce Setting (31–38°F)
• Strawberries, Raspberries,
Kiwifruit, Pears, Cherries,
Blackberries, Grapes, Plums,
Nectarines, Apples
• Asparagus, Broccoli, Corn,
Mushrooms, Spinach,
Cauliflower, Kale, Green
2QLRQV%HHWV2QLRQV
Meat Setting (27–37°F)
• Raw Meat, Fish and Poultry
15 Minutes
• 1 Beverage Can (12 oz)
• 2 Small Juice Boxes
(6–8 oz each)
30 Minutes
• Wine (750 ml bottle)
• 2 to 6 Beverage Cans
(12 oz each)
• 2 Plastic 20 oz Bottles
of Beverage
• 4 to 6 Small Juice Boxes
(6–8 oz each)
• 3 Foil Juice Packets
45 Minutes
• 2 Liter of Beverage
• 1/2 Gallon of Juice
• *HODWLQ³SDFNDJH
0.5 Lbs. (4 hours)
• Individually Wrapped
Filet Mignon (0.5 lb)
• Hamburger Patties (0.5 lb)
1.5 Lbs. (8 hours)
• Chicken Breasts (1.5 lbs)
• Ground Beef (1.5 lbs)
• Steak (1.5 lbs)
3.0 Lbs. (12 hours)
• Chicken Breasts (3.0 lbs)
• Ground Beef (3.0 lbs)
• Steak (3.0 lbs)
Control
lock
Control Lock
Press and hold this pad for 3 seconds to lock
the settings for the Climate Control drawer.
To unlock, press and hold for another 3 seconds.

15
Sealed
deli pan
Use the Sealed Deli Pan for the convenient
storage of lunch meats and cheese, hors
d’oeuvres, spreads and snacks. The pan and
shelf to which it is attached can be adjusted
to any height.
Excess water that may accumulate in the
bottom of the drawers should be emptied and
the drawers wiped dry.
Storage Pans and Climate Control Drawer
Built-In Refrigerators
Sealed
produce
pans
The top pan is designed to provide constant high
humidity levels.
Make sure the drawers are closed completely
to maintain the correct humidity level.
Excess water that may accumulate in the
bottom of the drawers should be emptied and
the drawers wiped dry.
Drawer
and pan
removal
To remove a drawer or pan:
1. Pull the pan out to the stop position.
2. Lift the front of the pan up and out of
the wire holder.
3. Lift the back of the pan up and out.
To replace a pan:
1. Place the back of the pan in the wire
holder, making sure the wire holder fits
into the grooves on the back of the pan.
2. Lower the front of the pan into the wire holder.
3. Press firmly on the top of the pan to snap it
into the wire holder.

The lighted vegetable drawer shelf provides
lighting for the lower compartments. The lights
are recessed into the shelf to illuminate the
drawers below.
To remove shelf:
1. Remove the top drawer (see Drawer and pan
removal section).
2. Push down gently on the back center of the
climate control drawer top surface to release
the bottom of the water tank cover. Pull out
and down to remove the water tank cover and
expose the wire harness.
3. Lift the shelf and carefully pull forward to expose
the wires.
4. Unplug the shelf and carefully remove it from
the refrigerator.
To replace shelf:
1. Carefully set the shelf onto the side rails, leaving
the plug exposed.
2. Plug the shelf into the refrigerator.
3. Carefully slide the shelf into place.
4. Insert the water tank cover top first so that
it goes up behind the gasket hanging down
from the vegetable drawer shelf. Gently push
the bottom of the water tank cover until the
bottom snaps into the the top of the Climate
Control Drawer cover.
5. Replace the drawer (see Drawer and pan
removal section).
16
Drop Down Shelf and Lighted Drawer Cover
Built-In Refrigerators
Drop down
shelf
The drop-down shelf gives you the use of
another full-size shelf when you need extra
storage. It conveniently folds back out of the way
when not in use, giving you room for storage of
larger items.
To use drop down shelf:
1. Pull forward and down to drop the shelf into
place.
2. Pull forward while lifting up to place the shelf out
of the way.
Lighted
vegetable
drawer
shelf
Water Tank
Cover
Water Tank Cover
Climate Control
Drawer Top
Surface
Lighted
Vegetable
Drawer Shelf

All door bins, except for the deep gallon door bin,
are adjustable using one of 2 tabs on each end
of the bin. They can be moved up and down to
many different positions to meet your storage
needs. The deep gallon door bin can be removed
for cleaning.
To remove any bin:
Lift the bin up and slide it toward you.
17
How to
rearrange
your shelves
Tempered glass shelves in the fresh food
compartment and wire shelves in the freezer
compartment are adjustable, enabling you to
make efficient shelf arrangements to fit your
family’s food storage needs.
To remove shelves:
Tilt shelf up at front, then lift it up and out
of tracks on rear wall of refrigerator.
To replace shelves:
Select desired shelf height. With shelf front
raised slightly, engage top lugs in tracks at rear
of cabinet. Then lower front of shelf until it locks
into position.
CAUTION
Do not clean glass shelves or
covers with warm water when they are cold. Glass
shelves and covers may break if exposed to sudden
temperature changes or impact, such as bumping or
dropping. Tempered glass is designed to shatter into
many small pieces if it breaks.
ATTENTION
Ne nettoyez pas les clayettes ou les
couvercles en verre avec de l’eau tiède quand ceux-ci
sont froids. Les clayettes et couvercles en verre peuvent
se casser s’ils sont exposés à des changements soudains
de température ou si vous les cognez ou les faites
tomber. Le verre trempé est conçu pour se briser en
petits morceaux en cas de casse.
Shelves and Bins
Built-In Refrigerators
Door bins
Adjustable
Door Bin
Gallon
Door Bin

18
Freezer
baskets
Wire slide-out freezer baskets can be pulled out
for easy access to frozen foods.
To remove:
Pull basket out. Lift the front of the basket up
and then take it out.
Shelves and Bins
Built-In Refrigerators
ZSAB1
Sabbath
Mode
Product Kit
(available at
extra cost)
The Sabbath Mode Product Kit was designed
for use on the Jewish Sabbath and Holidays.
The Sabbath Mode feature makes it possible for
observant Jews to refrigerate and freeze food
during the duration of the holiday.
The Sabbath Mode feature can be set to override
typical reactions to actions in your refrigerator.
While in the Sabbath Mode, your refrigerator will
still operate normally. However, the refrigerator
will not respond to your actions.
While in the Sabbath Mode, you may notice the
fan running when the door is opened; however,
this is not a result of your actions. The fan will
operate at random times. The defrost heater
will continue to defrost the refrigerator and
freezer and will be activated on a timer. The
defrost heater will not defrost as a result of door
openings or any consumer actions.
212))³To activate, raise the top grille panel
and set the Sabbath Mode switch to the ON
position. A green LED light will be visible below
the Sabbath Mode Kit switch. The light will be
visible when the grille is closed between the grille
door and compartment doors.
',63/$<6$/$506DQG/,*+76³The main
temperature control and Express Chill displays
will be deactivated; therefore they will not be lit,
sound a tone or operate when touched. Door
alarms and lights will be disabled.
,&(DQG:$7(5',63(16(5³The proximity
sensor and dispenser touch sensor icons will
not operate. Ice or water cannot be retrieved
from the dispenser.
,&(0$.(5³The icemaker will continue to
operate. The icemaker can be disabled by
opening the freezer, opening the ice storage bin
door and setting the icemaker power switch to
the OFF position (see Automatic Icemaker). To
obtain ice, open the freezer door and remove the
cubed ice from the ice bin.
This Sabbath Mode Product Kit can be purchased
from your local appliance dealer. The ZSAB1 Kit is
designed for use with all Monogram Built-In Side-
by-Side Refrigerators manufactured after 2008.
To locate your nearest dealer, visit our web site
monogram.com or call 1.877.959.8688. In Canada,
FDOO2UGHU.LW=6$%
NOTE: The Sabbath Mode Product Kit must be
installed by a qualified service technician.
(with kit installed
and icemaker OFF)

19
Cleaning
outside
The dispenser spill shelf
and the area beneath
it should be cleaned
periodically with a mild
liquid dish detergent.
'LVSHQVHUFUDGOH³Before cleaning, lock the
dispenser by touching CONTROL LOCK for
3 seconds to prevent activating the dispenser.
Clean with warm water and a mild liquid dish
detergent. Rinse thoroughly and wipe dry. Unlock
the dispenser by touching CONTROL LOCK for 3
seconds.
Do not use chemical cleaners to clean
the dispenser or any part of the dispenser.
'RRUKDQGOHVDQGWULP³Clean with a cloth
dampened with soapy water. Dry with a soft
cloth.
Keep the outside clean. Wipe with a clean cloth
lightly dampened with mild liquid dish detergent.
Dry with a clean, soft cloth.
Do not wipe the refrigerator with a soiled dish
cloth or wet towel. These may leave a residue
that can damage the finish. Do not use scouring
pads, powdered cleaners, bleach or cleaners
containing bleach because these products can
scratch and damage the finish.
6WDLQOHVVVWHHO³Regularly clean and polish the
stainless steel door panels and handles (on some
models) with a commercially available stainless
steel cleaner such as Stainless Steel Magic™ to
preserve and protect the fine finish. Stainless
Steel Magic and the Monogram polishing cloth
are available through GE Appliances Parts and
Accessories, 877.959-8688, or monogram.com.
For Stainless Steel Magic, order part number
WX10X15. For Monogram polishing cloth, order
part number WX72X10001.
Do not use appliance wax or polish on the
stainless steel.
Care and Cleaning
Built-In Refrigerators
Cleaning
inside
To help prevent odors. leave
an open box of baking soda in
the unit.
Turn off power at the circuit
breaker or fuse box before
cleaning. If this is not practical,
wring excess moisture out of
sponge or cloth when cleaning around switches,
lights or controls.
8VHZDUPZDWHUDQGEDNLQJVRGDVROXWLRQ³
about a tablespoon (15 ml) of baking soda to
a quart (1 liter) of water. This both cleans and
neutralizes odors. Thoroughly rinse and wipe dry.
Other parts of the refrigerator³LQFOXGLQJ
door gaskets, meat and vegetable drawers, ice
VWRUDJHELQDQGDOOSODVWLFSDUWV³FDQEHFOHDQHG
the same way. After cleaning the door gaskets,
apply a thin layer of petroleum jelly to the door
gaskets sealing surface on the hinge side.
This helps keep the gaskets from sticking and
bending out of shape.
Do not wash any plastic refrigerator parts
in the dishwasher.
Avoid cleaning cold glass shelves with hot
water because the extreme temperature
difference may cause them to break. Handle
glass shelves carefully. Rough handling of
tempered glass can cause it to shatter.

Using
the Master
Light switches
This feature turns off the lights in the fresh food
and freezer compartments.
The switches are located behind the grille panel
at the top of the refrigerator. Lift up the panel
to access the switches.
Fresh Food and Freezer
Master Light Switches
Refrigerator
Lights
There is LED lighting in the fresh food and freezer
compartments.
An authorized technician will need to replace the
LED lights.
If this assembly needs to be replaced, call GE
Appliances Service at1.800.432.2737 in the
United States or 1.800.561.3344 in Canada.
Care and Cleaning
Built-In Refrigerators
Grille
Panel
20

21
Care and Cleaning
Built-In Refrigerators
Preparing
for vacation
For long vacations or absences, remove food
and shut off power to the refrigerator at the fuse
box or circuit breaker. Clean the interior (see
Cleaning Inside). Leave doors open.
For shorter vacations, remove perishable foods
and leave controls at regular settings. However, if
the room temperature is expected to drop below
60°F (16°C), follow the same instructions as for
long vacations.
Set the icemaker power switch to the OFF
position and be sure to shut off the water supply
to the refrigerator.

22
Questions?
Use this
problem
solver!
The Problem Solver
Built-In Refrigerators
PROBLEM POSSIBLE CAUSE
REFRIGERATOR • May be in defrost cycle when compressor does not operate for about
DOES NOT OPERATE 30 minutes.
• Temperature control set at OFF.
• If interior light is not on, refrigerator may not be plugged in at
wall outlet.
• The fuse is blown/circuit breaker is tripped. Replace fuse or reset
the breaker.
• The Sabbath Mode Kit may be installed and operating. Turn off
the Sabbath Mode device.
MOTOR OPERATES • Normal when refrigerator is first plugged in. Wait 24 hours for
FOR LONG PERIODS the refrigerator to completely cool down.
OR CYCLES ON AND
• The new variable speed compressor is designed to run for longer
OFF FREQUENTLY
periods of time to optimize efficiency and noise. You may notice
the compressor and/or fan speeds accelerate based upon door
openings and/or increased food loads.
• You may hear the fans spinning at high speeds. This happens when
the refrigerator is first plugged in, when the doors are opened
frequently or when a large amount of food is added to the
refrigerator or freezer compartments. The fans are helping to
maintain the correct temperatures.
• Door left open or package holding door open.
• If either door is open for over 3 minutes, you may hear the fans
come on in order to cool the light.
• Hot weather or frequent door openings. This is normal.
• Temperature controls set at the coldest setting. See Temperature
Controls.
OPERATING • The variable speed compressor changes speeds and sounds
SOUNDS may vary.
1RUPDOIDQDLUIORZ³RQHIDQEORZVFROGDLUWKURXJKWKH
IUHVKIRRGDQGIUHH]HUFRPSDUWPHQWV³DQRWKHUIDQFRROV
the compressor motor.
• The fans change speeds in order to provide optimal cooling and
energy savings.
7KHVH1250$/VRXQGVZLOODOVREHKHDUGIURPWLPHWRWLPH
– You may hear a whooshing or gurgling sound when the doors close.
This is due to pressure equalizing within the refrigerator.
– A water dripping noise may occur during the defrost cycle as ice
melts from the evaporator and flows into the drain pan.
– The flow of refrigerant through the freezer cooling coils may make
a gurgling noise like boiling water.
– Water dropping on the defrost heater can cause a sizzling, popping
or buzzing sound during the defrost cycle.
– You may hear cracking or popping sounds when the refrigerator
is first plugged in or during/after the defrost cycle. This happens as
the refrigerator cools to the correct temperature.
– Electronic dampers click open and closed to provide optimal cooling
and energy savings.
– The compressor may cause a clicking or chirping sound when
attempting to restart (this could take up to 5 minutes).
– The electronic control board may cause a clicking sound when relays
activate to control refrigerator components.
– Ice cubes dropping into the bin and water running in pipes
as icemaker refills.
– The icemaker water valve will buzz when the icemaker fills
with water.
(Modern refrigerators
with more storage
space and a larger
freezer require
more operating time.
They start and stop
often to maintain
even temperatures.)

Questions?
Use this
problem
solver!
The Problem Solver
Built-In Refrigerators
PROBLEM POSSIBLE CAUSE
DOOR NOT CLOSING • Package may be holding door open.
PROPERLY
• Check the door gasket; it may be out of position.
• Refrigerator is not level. See Installation Instructions.
ACTUAL • Refrigerator just plugged in. Allow 24 hours for system to stabilize.
TEMPERATURE
• Door open for too long. Allow 24 hours for system to stabilize.
NOT EQUAL TO SET
• Warm food added to refrigerator. Allow 24 hours for system TEMPERATURE
to stabilize.
• Defrost cycle is in process. Allow 24 hours for system to stabilize.
VIBRATION OR • Refrigerator may not be properly installed.
RATTLING
(Slight vibration
is normal.)
FRESH FOOD • Temperature controls not set cold enough. See Temperature Controls.
OR FREEZER
• Warm weather or frequent door openings.
COMPARTMENT
• Door left open for long time.TOO WARM
• Package may be holding door open.
FROST OR ICE • Door left open or package holding door open.
CRYSTALS ON
• Too frequent or too long door openings.
FROZEN FOOD
(Frost within package
is normal.)
SLOW ICE CUBE • Door may have been left open.
FREEZING
• Freezer compartment is too warm. Set the freezer to a colder
temperature.
• Packages may be holding door open.
ICE HAS 2OGFXEHVQHHGWREHGLVFDUGHG
ODOR/TASTE
• Ice storage bin needs to be emptied and washed.
• Unsealed packages in freezer and fresh food compartments may
be transmitting odor/taste to ice.
• Keep open box of baking soda in refrigerator; replace every 3 months.
• Poor-tasting incoming water. Replace water filter.
AUTOMATIC • Icemaker power switch is in the OFF position.
ICEMAKER
• Water supply turned off or not connected.
DOES NOT WORK
• Freezer compartment too warm.
• Piled up cubes in storage bin may cause icemaker to shut off
too soon. Level cubes in bin.
MOISTURE FORMS • Not unusual during periods of high humidity. Wipe surface dry.
ON CABINET
• Controlling humidity and temperature in the kitchen with air
SURFACE BETWEEN
conditioning will eliminate this condition.
THE DOORS
23

24
Questions?
Use this
problem
solver!
PROBLEM POSSIBLE CAUSE
MOISTURE • Too frequent or long door openings.
COLLECTS INSIDE
• In humid weather, air carries moisture into refrigerator when doors
are opened.
• Controlling humidity and temperature in the kitchen with air
conditioning will eliminate this condition.
REFRIGERATOR • Foods with strong odors should be tightly covered.
HAS ODOR
• Check for spoiled food.
• Interior needs cleaning. See Care and Cleaning.
• Keep open box of baking soda in refrigerator; replace every
3 months.
INTERIOR LIGHT • No power at outlet.
DOES NOT WORK
• Master Light switch is in the OFF position.
SMALL OR • Water filter clogged. Replace the filter or use the filter bypass plug.
HOLLOW CUBES
• &KHFNIRUDFRQQHFWLRQWRD5HYHUVH2VPRVLVZDWHUV\VWHP
,IDQ52LVFRQQHFWHGUHPRYHWKHZDWHUILOWHUDQGLQVWDOOWKH
original bypass plug that came with the unit.
WATER ON • If you use an extra tall glass or pitcher, or overfill a glass or pitcher,
THE FLOOR you may be jamming the cubes in the funnel chute. They can fuse
inside the chute and drop out later, leaving water or ice on the floor.
UNEVEN SPACING
• Kitchen cabinets are not level or square. Call the installer or
OR GAPS
BETWEEN
cabinetmaker.
DOORS AND
KITCHEN CABINET
POOR DOOR • Fresh food door needs adjusting. See Installation Instructions.
• Refrigerator is not level. See Attention Installer Instructions.
WATER HAS POOR • Water dispenser has not been used for a long time. Dispense water
TASTE OR ODOR until all water in system is replenished.
WATER IN FIRST • Normal when refrigerator is first installed. Wait 24 hours for the
GLASS IS WARM refrigerator to completely cool down.
• Water dispenser has not been used for a long time. Dispense water
until all water in system is replenished.
• Water system has been drained. Allow several hours for replenished
supply to chill.
ALIGNMENT OR
ONE DOOR HIGHER
THAN THE OTHER
The Problem Solver
Built-In Refrigerators

Questions?
Use this
problem
solver!
The Problem Solver
Built-In Refrigerators
PROBLEM POSSIBLE CAUSE
WATER DISPENSER • Water supply line turned off, restricted or not connected. Call your
DOES NOT WORK installer for proper water supply line connection.
• Water filter clogged. Replace the filter or use the filter bypass plug.
• The CONTROL LOCK on the dispenser has been activated.
To unlock the dispenser, touch CONTROL LOCK for 3 seconds.
• Air may be trapped in system. Press the dispenser arm for at least
2 minutes.
ICE DISPENSER • Ice bin improperly installed. See Ice storage bin.
DOES NOT WORK
• Icemaker turned off or water supply turned off. Turn on icemaker
or water supply.
• Ice cubes are frozen to the icemaker feeler arm. Remove cubes.
• Irregular ice clumps in storage bin. Break up with fingertip pressure
and discard remaining clumps.
• Freezer may be too warm. Adjust freezer control to a colder setting,
one position at a time, until clumps do not form.
• Water filter clogged. Replace the filter or use the filter bypass plug.
• 7KH&21752//2&.RQWKHGLVSHQVHUKDVEHHQDFWLYDWHG
7RXQORFNWKHGLVSHQVHUWRXFK&21752//2&.IRUVHFRQGV
WATER SPURTING • Newly installed filter cartridge. Run water from the dispenser for
FROM DISPENSER 1 1/2 gallons (3 mins) .
NO WATER OR ICE • Water supply line turned off, restricted or not connected. Call your
PRODUCTION installer for proper water supply line connection.
• Water filter clogged. Replace the filter or use the filter bypass plug.
CUBED ICE WAS • Last setting was CRUSHED ICE. A few cubes were left in the crusher
SELECTED BUT from the previous setting. This is normal.
CRUSHED ICE
• If continual crushed ice is dispensed while cubed ice is selected,
WAS DISPENSED
adjust ice bin. See Ice storage bin.
• Packaging. Increase time or re-package in plastic.
• Wrong weight selected. Select a larger weight.
• Item with high fat content. Select a larger weight.
SELECT TEMP • Fresh Food temperature control is set at warmest setting.
FEATURE ON This is normal. In order to minimize energy usage, the Select Temp
CLIMATE CONTROL feature is disabled when the Fresh Food control is set at the warmest
DRAWER IS NOT setting.
WORKING
CLIMATE CONTROL • Control Lock feature is active. Press and hold the CONTROL LOCK
DRAWER CONTROLS pad on the Climate Control drawer for 3 seconds.
DO NOT WORK
FOOD IS NOT
THAWING/CHILLING
IN CLIMATE
CONTROL DRAWER
25

The following pharmaceutical reduction claims have not been certi¿ed by NSF International or the state of California.
Claims tested and veri¿ed by independent laboratory:
Contaminant
Reduction AvHUDJH,Q¾XHQW
16)VSHFL½HG
Challenge Concentration
Avg %
Reduction
Average Product
Water
Concentration
Max Permissible
Product Water
Concentration
NSF Reduction
Requirements
NSF
Test Report
Atenolol 978 ng/L N/A 99.5% 5.0 ng/L N/A N/A J-00121587
Fluoxetine 907 ng/l N/A 99.4% 5.4 ng/L N/A N/A J-00121587
Ibuprofen 885 ng/L N/A 94.1% 52.3 ng/L N/A N/A J-00121588
Progesterone 1097 ng/L N/A 99.5% 5.0 ng/L N/A N/A J-00121589
Trimethoprim 415 ng/L N/A 99.5% 2.0 ng/L N/A N/A J-00121587
It is essential that the manufacturer’s recommended installation, maintenance and filter replacement requirements be carried out for the product to perform as advertised.
See Installation Manual for Warranty information.
Application Guidelines/Water Supply Parameters
Service Flow 0.5 gpm (21.9 lpm)
Water Supply Potable Water
Water Pressure 40-120 psi (2.8-8.2 bar)
Water Temperature 33°F-100°F (0.6°C-38°C)
Note: While the testing was performed under standard laboratory conditions,
actual performance may vary.
Replacement Cartridge: MWF. For estimated costs of replacement elements
please call 1-800-626-2002 or visit our website at www.geapplianceparts.com.
WARNING
To reduce the risk associated with ingestion of contaminants:
• Do not use with water that is microbiologically unsafe or of unknown quality
without adequate disinfection before and after the system. Systems certL¿ed
for cyst reduction may be used on disinfected water that may contain ¿lterable
cysts. EPA Establishment Number 10350-MN-005.
NOTICE
To reduce the risk associated with property damage due to water leakage:
• Read and follow use instructions before installation and use of this system.
• Installation and use MUST comply with all state and local plumbing codes.
• Do not install if water pressure exceeds 120 psi (8.2 bar). If your water pressure
exceeds 80 psi, you must install a pressure-limiting valve. Contact a plumbing
professional if you are uncertain how to check your water pressure.
• Do not install where water hammer conditions may occur. If water hammer
conditions exist you must install a water hammer arrester. Contact a plumbing
professional if you are uncertain how to check for this condition.
• Do not install on hot water supply lines. The maximum operating water
temperature of this ¿lter system is 100º F (38º C).
• Protect ¿lter from freezing. Drain ¿lter when temperatures drop
below 33ºF (0.6ºC).
•
must be replaced every 6 months at the
rated capacity, or sooner if a noticeable reduction in ÀRw rate occurs.
For conditions of use, health claims certified by the California Department of Public
Health, and replacements, see performance data sheet. California Department
of Public Health Certification #05-1698. The contaminants or other substances
removed or reduced by this water filter are not necessarily in all users’ water.
Tested and cerWL½ed by NSF International
against NSF/ANSI Standard 42 and
Standard 53 in model GE MWF for the
reduction of the claims speci½Hd on the
performance data sheet.
REPLACEMENT
ELEMENT
Performance Data Sheet
SmartWater
™
Filtration System³GE MWF Cartridge
Performance Data Information
Capacity: 300 Gallons (1,135 Liters)
7KHFRQFHQWUDWLRQRIWKHFRQWDPLQDQWVWHVWHGIRUWKLV¿OWHULQZDWHUHQWHULQJWKHV\VWHPZDVUHGXFHGWR
DFRQFHQWUDWLRQOHVVWKDQRUHTXDOWRWKHSHUPLVVLEOHOLPLWIRUZDWHUOHDYLQJWKHV\VWHPDVVSHFL¿HGLQ
16)$16,6WDQGDUGDQG6WDQGDUG6\VWHPWHVWHGDQGFHUWL¿HGE\16),QWHUQDWLRQDODJDLQVW16)
ANSI Standard 42 and Standard 53.
Please see geappliances.com for complete listing of the contaminants tested and the amounts reduced
26

27
With the purchase of your new Monogram appliance,
receive the assurance that if you ever need information
or assistance from GE Appliances, we will be there. All you
have to do is call!
GE Appliances
Answer Center
®
In the USA:
800.626.2005
Whatever your question about any Monogram major appliance, GE Appliances Answer Center
LQIRUPDWLRQVHUYLFHLVDYDLODEOHWRKHOS<RXUFDOO³DQG\RXUTXHVWLRQ³ZLOOEHDQVZHUHG
promptly and courteously. Call the GE Appliances Answer Center
Monday to Friday, 8 a.m. to
10 p.m. EST, and Saturday, 8 a.m. to 7. p.m. EST.
OR
9LVLWRXU:HEVLWHDWmonogram.com
In Canada, call 1.800.561.3344.
In-Home Repair
Service
In the USA:
800.432.2737
In Canada:
1.800.561.3344
A GE Appliances consumer service professional will provide expert repair service, scheduled
at a time that’s convenient for you. To schedule service, call Monday to Friday, 7 a.m. to 10
p.m. EST, or Saturday and Sunday, 8 a.m. to 6 p.m. EST. Many GE Appliances Consumer Service
company- operated locations offer you service today or tomorrow, or at your con venience.
2XUIDFWRU\WUDLQHGWHFKQLFLDQVNQRZ\RXUDSSOLDQFHLQVLGHDQGRXW³VRPRVWUHSDLUVFDQEH
handled in just one visit.
,Q&DQDGD0RQGD\WR)ULGD\DPWRSPDQG6DWXUGD\DPWRSP('67
Service Contracts
In the USA:
800.626.2224
In Canada:
1.800.290.9029
You can have the secure feeling that GE Appliances Consumer Service will still be there after
your warranty expires. Purchase a GE Appliances contract while your warranty is still in effect
and you’ll receive a substantial discount. With a multiple -year contract, you’re assured of
future service at today’s prices.
Parts and
Accessories
In the USA:
877.959.8688
In Canada:
1.800.561.3344
Individuals qualified to service their own appliances can have parts or accessories sent
directly to their home. The GE Appliances parts system provides access to over 47,000 parts…
and all GE Appliances Genuine Renewal Parts are fully warranted. VISA, MasterCard and
Discover cards are accepted. Visit www.geappliances.com.
User maintenance instructions contained in this manual cover procedures intended
to be performed by any user. Other servicing generally should be referred to qualified
service personnel. Caution must be exercised, since improper servicing may cause unsafe
operation.
For Customers
With Special
Needs…
In the USA:
800.626.2005
GE Appliances offers Braille controls for a variety of GE Appliances
appliances, and a brochure to assist in planning a barrier-free kitchen
for persons with limited mobility.
Consumers with impaired hearing or speech who have access to a
TDD
or a conventional teletypewriter may call 800.TDD.GEAC (800.833.4322)
to request information or service.
Consumer Services
Built-In Refrigerators

Warranty
Built-In Refrigerators
YOUR MONOGRAM REFRIGERATOR WARRANTY
Staple sales slip or cancelled check here. Proof of original
purchase date is needed to obtain service under warranty.
WHAT IS
COVERED
From the Date
of the Original
Purchase
LIMITED TWO-YEAR WARRANTY
For two years from date of original purchase, we will provide, free of charge, parts and service labor in
your home to repair or replace any part of the refrigerator that fails because of a manufacturing defect.
LIMITED FIVE-YEAR WARRANTY
For five years from date of original purchase, we will provide, free of charge, parts and service labor
in your home to repair or replace any part of the sealed refrigerating system (the compressor, condenser,
evaporator and all connecting tubing) that fails because of a manufacturing defect.
LIMITED ADDITIONAL SIXTH- THROUGH TWELFTH-YEAR WARRANTY ON THE SEALED SYSTEM
For the sixth through twelfth year from the date of the original purchase, we will provide, free of charge,
replacement parts for any part of the sealed refrigerating system (the compressor, condenser, evaporator and
all connecting tubing) that fails because of a manufacturing defect. You pay for the service trip to your home
and for service labor charges.
LIMITED THIRTY-DAY WARRANTY ON WATER FILTER CARTRIDGE Appliances (Water filter, if included)
From the date of the original purchase we will provide, free of charge, replacement parts for any part of
the water filter cartridge that fails because of a manufacturing defect. During this limited thirty-day warranty,
we will also provide, free of charge, a replacement water filter cartridge.
This warranty is extended to the original purchaser and any succeeding owner for products purchased for
ordinary home use in the 48 mainland states, Hawaii, Washington, D.C. or Canada. If the product is located
in an area where service by a GE Appliances Authorized Servicer is not available, you may be responsible for
a trip charge or you may be required to bring the product to an Authorized GE Appliances Service location for
service. In Alaska the warranty is the same except that it is LIMITED because you must pay to ship the product
to the service shop or for the service technician’s travel costs to your home.
All warranty service will be provided by our Factory Service Centers or by our authorized Customer Care
servicers during normal working hours.
Should your appliance need service, during warranty period or beyond, in the USA call 800.432.2737.
,Q&DQDGD3OHDVHKDYH\RXUVHULDOQXPEHUDQGPRGHOQXPEHUDYDLODEOHZKHQFDOOLQJIRUVHUYLFH
Some states/provinces do not allow the exclusion or limitation of incidental or consequential damages,
so the above limitation or exclusion may not apply to you. This warranty gives you specific legal rights, and you
may also have other rights which vary from state to state/province to province. To know what your legal rights
are in your state/province, consult your local or state/provincial consumer affairs office or your state’s Attorney
General.
Warrantor in USA: GE Appliances,
Louisville, KY 40225
Warrantor in Canada: Mabe Canada Inc.
WHAT IS NOT
COVERED
• Service trips to your home to teach you how
to use the product.
• Replacement of house fuses or resetting of circuit
breakers.
• Damage to the product caused by accident, fire,
floods or acts of God.
• Failure of the product if it is used for other than
its intended purpose or used commercially.
• Damage caused after delivery.
• Improper installation, delivery or maintenance.
If you have an installation problem, contact
your dealer or installer. You are responsible
for providing adequate electrical, plumbing
and other connecting facilities.
• Replacement of the light bulbs, if included,
or water filter cartridge, if included, other
than as noted above.
• Replacement of the water filter cartridge,
if included, due to water pressure that is outside
the specified operating range or due to excessive
sediment in the water supply.
• Loss of food due to spoilage (in the USA only).
• Incidental or consequential damage caused
by possible defects with this appliance.
• Product not accessible to provide required
service.
• Damage caused by a non-GE Appliances brand
water filter.
Printed in the United States
(;&/86,212),03/,(':$55$17,(6³<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQ
this Limited Warranty. Any implied warranties, including the implied warranties of merchantability or
fitness for a particular purpose, are limited to one year or the shortest period allowed by law.
04-16 GE
224D1893P008
49-60753-1
Appliance Park
Louisville, KY 40225
