Loading ...
Loading ...
Loading ...
22 49-80713 Rev. 2
Oven Light Replacement
The oven light bulb is covered with a removable glass
cover that is held in place with a bail-shaped wire.
Remove the oven door, if desired, to reach the cover
easily.
To remove:
+ROGDKDQGXQGHUWKHFRYHUVRLWGRHVQ¶WIDOOZKHQ
released. With fingers of the same hand, firmly push
back the wire cover holder. Lift off the cover.
Do not remove any screws to remove the cover.
2. Do not touch hot bulb with a wet cloth. Replace bulb
ZLWKDZDWWKRXVHKROGDSSOLDQFHEXOE
To replace cover:
3ODFHLWLQWRWKHJURRYHRIWKHOLJKWUHFHSWDFOH3XOOWKH
wire forward to the center of the cover until it snaps into
place. When in place, the wire holds the cover firmly.
%HFHUWDLQWKHZLUHLVLQWKHGHSUHVVLRQLQWKHFHQWHURI
the cover.
2. Connect electrical power to the oven.
Removable Oven Bottom
The oven bottom can be removed to clean large spills,
and to enable you to reach the oven burner. Oven bottom
must be replaced before using the self-clean cycle.
To remove:
6OLGHWKHWDEDWWKHFHQWHUIURQWRIWKHRYHQERWWRPWR
the left.
2. Lift the oven bottom up and out.
To replace:
6OLSWKHRYHQERWWRPLQWRWKHRYHQVRWKHWDEVLQWKH
rear of the oven bottom fit into the slots in the oven
back.
2. Lower the front of the oven bottom into place and slide
the front tab to the right to lock the oven bottom into
place.
The oven bottom has a porcelain enamel finish. To make
cleaning easier, protect the oven bottom from excessive
spillovers by placing a cookie sheet on the rack below
the rack you are cooking on. This is particularly important
when baking a fruit pie or other foods with a high acid
content. Hot fruit fillings or other foods that are highly
DFLGLFVXFKDVWRPDWRHVVDXHUNUDXWDQGVDXFHVZLWK
YLQHJDURUOHPRQMXLFHPD\FDXVHSLWWLQJDQGGDPDJH
to the porcelain enamel surface and should be wiped up
immediately.
We don’t recommend using aluminum foil on the oven
bottom. It can affect air flow if the holes are blocked and it
can concentrate heat at the bottom of the oven, resulting
in poor baking performance.
To clean up spillovers, use soap and water, an abrasive
cleaner or soap-filled scouring pad. Rinse well to remove
any soap before self-cleaning.
Oven Racks
Clean the oven racks with an abrasive cleanser or steel
wool. After cleaning, rinse the racks with clean water and
dry with a clean cloth.
NOTE: 7KHVKLQ\VLOYHUFRORUHGRYHQUDFNVRQVRPH
PRGHOVPD\EHFOHDQHGLQWKHVHOIFOHDQLQJRYHQ
However, the racks will darken in color, lose their luster
and become hard to slide if cleaned during the self-
cleaning cycle.
To make the racks slide more easily, apply a small
amount of vegetable oil to a paper towel and wipe the
edges of the oven racks with the paper towel.
NOTE:8VLQJRWKHUFRRNLQJRLOVZLOOFDXVHDGLVFRORULQJ
or a rust like color residue on the racks and cavity sides.
To clean this residue, use a soap and water or a vinegar
and water solution. Rinse with clean water and dry with a
soft cloth.
CARE AND CLEANING
Care and Cleaning
Wire cover holder
8QORFN Lock
Loading ...
Loading ...
Loading ...